You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameApelin receptor
Synonyms
  • AGTRL1
  • Angiotensin receptor-like 1
  • APJ
  • G-protein coupled receptor APJ
  • G-protein coupled receptor HG11
Gene NameAPLNR
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013922|Apelin receptor
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK
RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL
TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ
CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL
RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV
NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK
GGEQMHEKSIPYSQETLVVD
Number of residues380
Molecular Weight42660.055
Theoretical pINot Available
GO Classification
Functions
  • receptor activity
  • G-protein coupled receptor activity
Processes
  • heart development
  • G-protein coupled receptor signaling pathway
  • gastrulation
  • regulation of body fluid levels
Components
  • plasma membrane
  • integral component of plasma membrane
General FunctionReceptor activity
Specific FunctionReceptor for apelin coupled to G proteins that inhibit adenylate cyclase activity and plays a role in various processes in adults such as regulation of blood pressure, heart contractility, and heart failure. Also plays a key role in early development such as gastrulation and heart morphogenesis by acting as a receptor for APELA hormone. Alternative coreceptor with CD4 for HIV-1 infection; may be involved in the development of AIDS dementia.
Pfam Domain Function
Transmembrane Regions27-51 67-91 101-125 145-166 201-221 245-271 285-308
GenBank Protein IDNot Available
UniProtKB IDP35414
UniProtKB Entry NameAPJ_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013923|Apelin receptor (APLNR)
ATGGAGGAAGGTGGTGATTTTGACAACTACTATGGGGCAGACAACCAGTCTGAGTGTGAG
TACACAGACTGGAAATCCTCGGGGGCCCTCATCCCTGCCATCTACATGTTGGTCTTCCTC
CTGGGCACCACGGGCAACGGTCTGGTGCTCTGGACCGTGTTTCGGAGCAGCCGGGAGAAG
AGGCGCTCAGCTGATATCTTCATTGCTAGCCTGGCGGTGGCTGACCTGACCTTCGTGGTG
ACGCTGCCCCTGTGGGCTACCTACACGTACCGGGACTATGACTGGCCCTTTGGGACCTTC
TTCTGCAAGCTCAGCAGCTACCTCATCTTCGTCAACATGTACGCCAGCGTCTTCTGCCTC
ACCGGCCTCAGCTTCGACCGCTACCTGGCCATCGTGAGGCCAGTGGCCAATGCTCGGCTG
AGGCTGCGGGTCAGCGGGGCCGTGGCCACGGCAGTTCTTTGGGTGCTGGCCGCCCTCCTG
GCCATGCCTGTCATGGTGTTACGCACCACCGGGGACTTGGAGAACACCACTAAGGTGCAG
TGCTACATGGACTACTCCATGGTGGCCACTGTGAGCTCAGAGTGGGCCTGGGAGGTGGGC
CTTGGGGTCTCGTCCACCACCGTGGGCTTTGTGGTGCCCTTCACCATCATGCTGACCTGT
TACTTCTTCATCGCCCAAACCATCGCTGGCCACTTCCGCAAGGAACGCATCGAGGGCCTG
CGGAAGCGGCGCCGGCTGCTCAGCATCATCGTGGTGCTGGTGGTGACCTTTGCCCTGTGC
TGGATGCCCTACCACCTGGTGAAGACGCTGTACATGCTGGGCAGCCTGCTGCACTGGCCC
TGTGACTTTGACCTCTTCCTCATGAACATCTTCCCCTACTGCACCTGCATCAGCTACGTC
AACAGCTGCCTCAACCCCTTCCTCTATGCCTTTTTCGACCCCCGCTTCCGCCAGGCCTGC
ACCTCCATGCTCTGCTGTGGCCAGAGCAGGTGCGCAGGCACCTCCCACAGCAGCAGTGGG
GAGAAGTCAGCCAGCTACTCTTCGGGGCACAGCCAGGGGCCCGGCCCCAACATGGGCAAG
GGTGGAGAACAGATGCACGAGAAATCCATCCCCTACAGCCAGGAGACCCTTGTGGTTGAC
TAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:339
Chromosome Location11
LocusNot Available
References
  1. O'Dowd BF, Heiber M, Chan A, Heng HH, Tsui LC, Kennedy JL, Shi X, Petronis A, George SR, Nguyen T: A human gene that shows identity with the gene encoding the angiotensin receptor is located on chromosome 11. Gene. 1993 Dec 22;136(1-2):355-60. 8294032
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334