You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameBeta-adrenergic receptor kinase 2
Synonyms
  • 2.7.11.15
  • BARK2
  • Beta-ARK-2
  • G-protein-coupled receptor kinase 3
  • GRK3
Gene NameADRBK2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009875|Beta-adrenergic receptor kinase 2
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFN
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
SHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNV
ELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRR
APKFLNKPRSGTVELPKPSLCHRNSNGL
Number of residues688
Molecular Weight79709.085
Theoretical pI7.67
GO Classification
Functions
  • ATP binding
  • protein kinase activity
  • G-protein coupled receptor kinase activity
  • beta-adrenergic receptor kinase activity
Processes
  • signal transduction
  • receptor internalization
General FunctionProtein kinase activity
Specific FunctionSpecifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID312395
UniProtKB IDP35626
UniProtKB Entry NameARBK2_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0009876|Beta-adrenergic receptor kinase 2 (ADRBK2)
ATGGCGGACCTGGAGGCTGTGCTGGCCGATGTCAGTTACCTGATGGCCATGGAGAAGAGC
AAGGCGACCCCGGCCGCCCGCGCCAGCAAGAGGATCGTCCTGCCGGAGCCCAGTATCCGG
AGTGTGATGCAGAAGTACCTTGCAGAGAGAAATGAAATAACCTTTGACAAGATTTTCAAT
CAGAAAATTGGTTTCTTGCTATTTAAAGATTTTTGTTTGAATGAAATTAATGAAGCTGTA
CCTCAGGTGAAGTTTTATGAAGAGATAAAGGAATATGAAAAACTTGATAATGAGGAAGAC
CGCCTTTGCAGAAGTCGACAAATTTATGATGCCTACATCATGAAGGAACTTCTTTCCTGT
TCACATCCTTTCTCAAAGCAAGCTGTAGAACACGTACAAAGTCATTTATCCAAGAAACAA
GTGACATCAACTCTTTTTCAGCCATACATAGAAGAAATTTGTGAAAGCCTTCGAGGTGAC
ATTTTTCAAAAATTTATGGAAAGTGACAAGTTCACTAGATTTTGTCAGTGGAAAAACGTT
GAATTAAATATCCATTTGACCATGAATGAGTTCAGTGTGCATAGGATTATTGGACGAGGA
GGATTCGGGGAAGTTTATGGTTGCAGGAAAGCAGACACTGGAAAAATGTATGCAATGAAA
TGCTTAGATAAGAAGAGGATCAAAATGAAACAAGGAGAAACATTAGCCTTAAATGAAAGA
ATCATGTTGTCTCTTGTCAGCACAGGAGACTGTCCTTTCATTGTATGTATGACCTATGCC
TTCCATACCCCAGATAAACTCTGCTTCATCCTGGATCTGATGAACGGGGGCGATTTGCAC
TACCACCTTTCACAACACGGTGTGTTCTCTGAGAAGGAGATGCGGTTTTATGCCACTGAA
ATCATTCTGGGTCTGGAACACATGCACAATCGGTTTGTTGTCTACAGAGATTTGAAGCCA
GCAAATATTCTCTTGGATGAACATGGACACGCAAGAATATCAGATCTTGGTCTTGCCTGC
GATTTTTCCAAAAAGAAGCCTCATGCGAGTGTTGGCACCCATGGGTACATGGCTCCCGAG
GTGCTGCAGAAGGGGACGGCCTATGACAGCAGTGCCGACTGGTTCTCCCTGGGCTGCATG
CTTTTCAAACTTCTGAGAGGTCACAGCCCTTTCAGACAACATAAAACCAAAGACAAGCAT
GAAATTGACCGAATGACACTCACCGTGAATGTGGAACTTCCAGACACCTTCTCTCCTGAA
CTGAAGTCCCTTTTGGAGGGCTTGCTTCAGCGAGACGTTAGCAAGCGGCTGGGCTGTCAC
GGAGGCGGCTCACAGGAAGTAAAAGAGCACAGCTTTTTCAAAGGTGTTGACTGGCAGCAT
GTCTACTTACAAAAGTACCCACCACCCTTGATTCCTCCCCGGGGAGAAGTCAATGCTGCT
GATGCCTTTGATATTGGCTCATTTGATGAAGAGGATACCAAAGGGATTAAGCTACTTGAT
TGCGACCAAGAACTCTACAAGAACTTCCCTTTGGTCATCTCTGAACGCTGGCAGCAAGAA
GTAACGGAAACAGTTTATGAAGCAGTAAATGCAGACACAGATAAAATCGAGGCCAGGAAG
AGAGCTAAAAATAAGCAACTTGGCCACGAAGAAGATTACGCTCTGGGGAAGGACTGTATT
ATGCACGGGTACATGCTGAAACTGGGAAACCCATTTCTGACTCAGTGGCAGCGTCGCTAT
TTTTACCTCTTTCCAAATAGACTTGAATGGAGAGGAGAGGGAGAGTCCCGGCAAAATTTA
CTGACAATGGAACAGATTCTCTCTGTGGAAGAAACTCAAATTAAAGACAAAAAATGCATT
TTGTTCAGAATAAAAGGAGGGAAACAATTTGTCTTGCAATGTGAGAGTGATCCAGAGTTT
GTGCAGTGGAAGAAAGAGTTGAACGAAACCTTCAAGGAGGCCCAGCGGCTATTGCGTCGT
GCCCCGAAGTTCCTCAACAAACCTCGGTCAGGTACTGTGGAGCTCCCAAAGCCATCCCTC
TGTCACAGAAACAGCAACGGCCTCTAG
GenBank Gene IDX69117
GeneCard IDNot Available
GenAtlas IDADRBK2
HGNC IDHGNC:290
Chromosome Location22
Locus22q11|22q12.1
References
  1. Parruti G, Ambrosini G, Sallese M, De Blasi A: Molecular cloning, functional expression and mRNA analysis of human beta-adrenergic receptor kinase 2. Biochem Biophys Res Commun. 1993 Jan 29;190(2):475-81. 8427589
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  3. Del Rincon SV, Rogers J, Widschwendter M, Sun D, Sieburg HB, Spruck C: Development and validation of a method for profiling post-translational modification activities using protein microarrays. PLoS One. 2010 Jun 28;5(6):e11332. doi: 10.1371/journal.pone.0011332. 20596523
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. 17344846