You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSterol regulatory element-binding protein 1
Synonyms
  • BHLHD1
  • Class D basic helix-loop-helix protein 1
  • SREBP-1
  • SREBP1
  • Sterol regulatory element-binding transcription factor 1
Gene NameSREBF1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009288|Sterol regulatory element-binding protein 1
MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTD
PASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGP
GIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGN
TQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLL
QPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDA
EKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKS
AVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE
VEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR
GMLDRSRLALCTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGW
AQWLLPPVVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQ
AAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRV
DASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSALNLAECAGDAVSVATLAEIYV
AAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDWSVL
STPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYL
QLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
VEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTP
ASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSS
LRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGKGGAVAELEPR
PTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMRLGG
GTTVTSS
Number of residues1147
Molecular Weight121673.6
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
  • RNA polymerase II core promoter proximal region sequence-specific DNA binding
  • transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
  • chromatin binding
  • transcription factor activity, sequence-specific DNA binding
  • sterol response element binding
Processes
  • lipid biosynthetic process
  • positive regulation of histone deacetylation
  • negative regulation of insulin secretion
  • regulation of heart rate by chemical signal
  • regulation of transcription from RNA polymerase II promoter
  • response to cAMP
  • regulation of protein targeting to mitochondrion
  • response to glucose
  • lung development
  • response to progesterone
  • insulin receptor signaling pathway
  • cellular response to starvation
  • positive regulation of transcription from RNA polymerase II promoter
  • response to glucagon
  • lipid metabolic process
  • circadian rhythm
  • negative regulation of transcription from RNA polymerase II promoter
  • cholesterol metabolic process
  • response to drug
  • positive regulation of cholesterol biosynthetic process
  • response to food
  • regulation of protein stability
  • cellular response to fatty acid
  • positive regulation of triglyceride biosynthetic process
  • regulation of fatty acid metabolic process
  • aging
  • small molecule metabolic process
  • regulation of mitophagy
  • response to retinoic acid
Components
  • cytosol
  • nucleoplasm
  • cytoplasm
  • protein complex
  • Golgi membrane
  • nucleus
  • endoplasmic reticulum
  • ER to Golgi transport vesicle membrane
  • nuclear envelope
  • endoplasmic reticulum membrane
  • integral component of membrane
General FunctionTranscriptional activator activity, rna polymerase ii core promoter proximal region sequence-specific binding
Specific FunctionTranscriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the fatty acid and to a lesser degree the cholesterol synthesis pathway (By similarity). Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3').
Pfam Domain Function
Transmembrane Regions488-508 548-568
GenBank Protein IDNot Available
UniProtKB IDP36956
UniProtKB Entry NameSRBP1_HUMAN
Cellular LocationEndoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0013721|Sterol regulatory element-binding protein 1 (SREBF1)
ATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGAT
CTGGACGCGGCGCTGCTGACCGACATCGAAGGTGAAGTCGGCGCGGGGAGGGGTAGGGCC
AACGGCCTGGACGCCCCAAGGGCGGGCGCAGATCGCGGAGCCATGGATTGCACTTTCGAA
GACATGCTTCAGCTTATCAACAACCAAGACAGTGACTTCCCTGGCCTATTTGACCCACCC
TATGCTGGGAGTGGGGCAGGGGGCACAGACCCTGCCAGCCCCGATACCAGCTCCCCAGGC
AGCTTGTCTCCACCTCCTGCCACATTGAGCTCCTCTCTTGAAGCCTTCCTGAGCGGGCCG
CAGGCAGCGCCCTCACCCCTGTCCCCTCCCCAGCCTGCACCCACTCCATTGAAGATGTAC
CCGTCCATGCCCGCTTTCTCCCCTGGGCCTGGTATCAAGGAAGAGTCAGTGCCACTGAGC
ATCCTGCAGACCCCCACCCCACAGCCCCTGCCAGGGGCCCTCCTGCCACAGAGCTTCCCA
GCCCCAGCCCCACCGCAGTTCAGCTCCACCCCTGTGTTAGGCTACCCCAGCCCTCCGGGA
GGCTTCTCTACAGGAAGCCCTCCCGGGAACACCCAGCAGCCGCTGCCTGGCCTGCCACTG
GCTTCCCCGCCAGGGGTCCCGCCCGTCTCCTTGCACACCCAGGTCCAGAGTGTGGTCCCC
CAGCAGCTACTGACAGTCACAGCTGCCCCCACGGCAGCCCCTGTAACGACCACTGTGACC
TCGCAGATCCAGCAGGTCCCGGTCCTGCTGCAGCCCCACTTCATCAAGGCAGACTCGCTG
CTTCTGACAGCCATGAAGACAGACGGAGCCACTGTGAAGGCGGCAGGTCTCAGTCCCCTG
GTCTCTGGCACCACTGTGCAGACAGGGCCTTTGCCGACCCTGGTGAGTGGCGGAACCATC
TTGGCAACAGTCCCACTGGTCGTAGATGCGGAGAAGCTGCCTATCAACCGGCTCGCAGCT
GGCAGCAAGGCCCCGGCCTCTGCCCAGAGCCGTGGAGAGAAGCGCACAGCCCACAACGCC
ATTGAGAAGCGCTACCGCTCCTCCATCAATGACAAAATCATTGAGCTCAAGGATCTGGTG
GTGGGCACTGAGGCAAAGCTGAATAAATCTGCTGTCTTGCGCAAGGCCATCGACTACATT
CGCTTTCTGCAACACAGCAACCAGAAACTCAAGCAGGAGAACCTAAGTCTGCGCACTGCT
GTCCACAAAAGCAAATCTCTGAAGGATCTGGTGTCGGCCTGTGGCAGTGGAGGGAACACA
GACGTGCTCATGGAGGGCGTGAAGACTGAGGTGGAGGACACACTGACCCCACCCCCCTCG
GATGCTGGCTCACCTTTCCAGAGCAGCCCCTTGTCCCTTGGCAGCAGGGGCAGTGGCAGC
GGTGGCAGTGGCAGTGACTCGGAGCCTGACAGCCCAGTCTTTGAGGACAGCAAGGCAAAG
CCAGAGCAGCGGCCGTCTCTGCACAGCCGGGGCATGCTGGACCGCTCCCGCCTGGCCCTG
TGCACGCTCGTCTTCCTCTGCCTGTCCTGCAACCCCTTGGCCTCCTTGCTGGGGGCCCGG
GGGCTTCCCAGCCCCTCAGATACCACCAGCGTCTACCATAGCCCTGGGCGCAACGTGCTG
GGCACCGAGAGCAGAGATGGCCCTGGCTGGGCCCAGTGGCTGCTGCCCCCAGTGGTCTGG
CTGCTCAATGGGCTGTTGGTGCTCGTCTCCTTGGTGCTTCTCTTTGTCTACGGTGAGCCA
GTCACACGGCCCCACTCAGGCCCCGCCGTGTACTTCTGGAGGCATCGCAAGCAGGCTGAC
CTGGACCTGGCCCGGGGAGACTTTGCCCAGGCTGCCCAGCAGCTGTGGCTGGCCCTGCGG
GCACTGGGCCGGCCCCTGCCCACCTCCCACCTGGACCTGGCTTGTAGCCTCCTCTGGAAC
CTCATCCGTCACCTGCTGCAGCGTCTCTGGGTGGGCCGCTGGCTGGCAGGCCGGGCAGGG
GGCCTGCAGCAGGACTGTGCTCTGCGAGTGGATGCTAGCGCCAGCGCCCGAGACGCAGCC
CTGGTCTACCATAAGCTGCACCAGCTGCACACCATGGGGAAGCACACAGGCGGGCACCTC
ACTGCCACCAACCTGGCGCTGAGTGCCCTGAACCTGGCAGAGTGTGCAGGGGATGCCGTG
TCTGTGGCGACGCTGGCCGAGATCTATGTGGCGGCTGCATTGAGAGTGAAGACCAGTCTC
CCACGGGCCTTGCATTTTCTGACACGCTTCTTCCTGAGCAGTGCCCGCCAGGCCTGCCTG
GCACAGAGTGGCTCAGTGCCTCCTGCCATGCAGTGGCTCTGCCACCCCGTGGGCCACCGT
TTCTTCGTGGATGGGGACTGGTCCGTGCTCAGTACCCCATGGGAGAGCCTGTACAGCTTG
GCCGGGAACCCAGTGGACCCCCTGGCCCAGGTGACTCAGCTATTCCGGGAACATCTCTTA
GAGCGAGCACTGAACTGTGTGACCCAGCCCAACCCCAGCCCTGGGTCAGCTGATGGGGAC
AAGGAATTCTCGGATGCCCTCGGGTACCTGCAGCTGCTGAACAGCTGTTCTGATGCTGCG
GGGGCTCCTGCCTACAGCTTCTCCATCAGTTCCAGCATGGCCACCACCACCGGCGTAGAC
CCGGTGGCCAAGTGGTGGGCCTCTCTGACAGCTGTGGTGATCCACTGGCTGCGGCGGGAT
GAGGAGGCGGCTGAGCGGCTGTGCCCGCTGGTGGAGCACCTGCCCCGGGTGCTGCAGGAG
TCTGAGAGACCCCTGCCCAGGGCAGCTCTGCACTCCTTCAAGGCTGCCCGGGCCCTGCTG
GGCTGTGCCAAGGCAGAGTCTGGTCCAGCCAGCCTGACCATCTGTGAGAAGGCCAGTGGG
TACCTGCAGGACAGCCTGGCTACCACACCAGCCAGCAGCTCCATTGACAAGGCCGTGCAG
CTGTTCCTGTGTGACCTGCTTCTTGTGGTGCGCACCAGCCTGTGGCGGCAGCAGCAGCCC
CCGGCCCCGGCCCCAGCAGCCCAGGGCACCAGCAGCAGGCCCCAGGCTTCCGCCCTTGAG
CTGCGTGGCTTCCAACGGGACCTGAGCAGCCTGAGGCGGCTGGCACAGAGCTTCCGGCCC
GCCATGCGGAGGGTGTTCCTACATGAGGCCACGGCCCGGCTGATGGCGGGGGCCAGCCCC
ACACGGACACACCAGCTCCTCGACCGCAGTCTGAGGCGGCGGGCAGGCCCCGGTGGCAAA
GGAGGCGCGGTGGCGGAGCTGGAGCCGCGGCCCACGCGGCGGGAGCACGCGGAGGCCTTG
CTGCTGGCCTCCTGCTACCTGCCCCCCGGCTTCCTGTCGGCGCCCGGGCAGCGCGTGGGC
ATGCTGGCTGAGGCGGCGCGCACACTCGAGAAGCTTGGCGATCGCCGGCTGCTGCACGAC
TGTCAGCAGATGCTCATGCGCCTGGGCGGTGGGACCACTGTCACTTCCAGCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:11289
Chromosome Location17
LocusNot Available
References
  1. Yokoyama C, Wang X, Briggs MR, Admon A, Wu J, Hua X, Goldstein JL, Brown MS: SREBP-1, a basic-helix-loop-helix-leucine zipper protein that controls transcription of the low density lipoprotein receptor gene. Cell. 1993 Oct 8;75(1):187-97. 8402897
  2. Hua X, Wu J, Goldstein JL, Brown MS, Hobbs HH: Structure of the human gene encoding sterol regulatory element binding protein-1 (SREBF1) and localization of SREBF1 and SREBF2 to chromosomes 17p11.2 and 22q13. Genomics. 1995 Feb 10;25(3):667-73. 7759101
  3. Harada N, Yonemoto H, Yoshida M, Yamamoto H, Yin Y, Miyamoto A, Hattori A, Wu Q, Nakagawa T, Nakano M, Teshigawara K, Mawatari K, Hosaka T, Takahashi A, Nakaya Y: Alternative splicing produces a constitutively active form of human SREBP-1. Biochem Biophys Res Commun. 2008 Apr 11;368(3):820-6. doi: 10.1016/j.bbrc.2008.02.004. Epub 2008 Feb 11. 18267114
  4. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Hua X, Sakai J, Brown MS, Goldstein JL: Regulated cleavage of sterol regulatory element binding proteins requires sequences on both sides of the endoplasmic reticulum membrane. J Biol Chem. 1996 Apr 26;271(17):10379-84. 8626610
  7. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  8. Parraga A, Bellsolell L, Ferre-D'Amare AR, Burley SK: Co-crystal structure of sterol regulatory element binding protein 1a at 2.3 A resolution. Structure. 1998 May 15;6(5):661-72. 9634703