You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamate receptor ionotropic, kainate 1
Synonyms
  • EAA3
  • Excitatory amino acid receptor 3
  • GluK1
  • GluR-5
  • GLUR5
  • Glutamate receptor 5
Gene NameGRIK1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000689|Glutamate receptor ionotropic, kainate 1
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCL
DLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECG
KLIREERGIRKQSSVHTV
Number of residues918
Molecular Weight103979.665
Theoretical pI7.09
GO Classification
Functions
  • kainate selective glutamate receptor activity
  • voltage-gated cation channel activity
  • drug binding
  • glutamate binding
  • extracellular-glutamate-gated ion channel activity
Processes
  • ion transmembrane transport
  • nervous system development
  • adult behavior
  • negative regulation of synaptic transmission, GABAergic
  • behavioral response to pain
  • central nervous system development
  • membrane depolarization
  • glutamate receptor signaling pathway
  • inhibitory postsynaptic potential
  • positive regulation of synaptic transmission, GABAergic
  • regulation of short-term neuronal synaptic plasticity
  • excitatory postsynaptic potential
  • synaptic transmission, glutamatergic
  • negative regulation of synaptic transmission, glutamatergic
  • transport
  • regulation of synaptic transmission, glutamatergic
  • positive regulation of gamma-aminobutyric acid secretion
  • synaptic transmission
Components
  • dendrite
  • neuronal postsynaptic density
  • neuronal cell body
  • presynaptic membrane
  • terminal bouton
  • postsynaptic membrane
  • plasma membrane
  • kainate selective glutamate receptor complex
  • cell junction
  • integral component of plasma membrane
General FunctionVoltage-gated cation channel activity
Specific FunctionIonotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus.
Pfam Domain Function
Transmembrane Regions577-597 654-674 835-855
GenBank Protein ID455448
UniProtKB IDP39086
UniProtKB Entry NameGRIK1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010256|Glutamate receptor ionotropic, kainate 1 (GRIK1)
ATGGAGCACGGCACACTCCTCGCCCAGCCCGGGCTCTGGACCAGGGACACCAGCTGGGCA
CTCCTCTATTTCCTCTGCTATATCCTCCCTCAGACCGCCCCGCAAGTACTCAGGATCGGA
GGGATTTTTGAAACAGTGGAAAATGAGCCTGTTAATGTTGAAGAATTAGCTTTCAAGTTT
GCAGTCACCAGCATTAACAGAAACCGAACCCTGATGCCTAACACCACATTAACCTATGAC
ATCCAGAGAATTAACCTTTTTGATAGTTTTGAAGCCTCGCGGAGAGCATGTGACCAGCTG
GCTCTTGGTGTGGCTGCTCTCTTTGGCCCTTCCCATAGCTCCTCCGTCAGTGCTGTGCAG
TCTATTTGCAATGCTCTCGAAGTTCCACACATACAGACCCGCTGGAAACACCCCTCGGTG
GACAACAAAGATTTGTTTTACATCAACCTTTACCCAGATTATGCAGCTATCAGCAGGGCG
ATCCTGGATCTGGTCCTCTATTACAACTGGAAAACAGTGACAGTGGTGTATGAAGACAGC
ACAGGTCTAATTCGTCTACAAGAGCTCATCAAAGCTCCCTCCAGATATAATATTAAAATC
AAAATCCGCCAGCTGCCCTCTGGGAATAAAGATGCCAAGCCTTTACTCAAGGAGATGAAG
AAAGGCAAGGAGTTCTATGTGATATTTGATTGTTCACATGAAACAGCCGCTGAAATCCTT
AAGCAGATTCTGTTCATGGGCATGATGACCGAGTACTATCACTACTTTTTCACAACCCTG
GACTTATTTGCTTTGGATCTGGAACTCTATAGGTACAGTGGCGTAAACATGACCGGGTTT
CGGCTGCTTAACATTGACAACCCTCACGTGTCATCCATCATTGAGAAGTGGTCCATGGAG
AGACTGCAGGCCCCACCCAGGCCCGAGACTGGCCTTTTGGATGGCATGATGACAACTGAA
GCGGCTCTGATGTACGATGCTGTGTACATGGTGGCCATTGCCTCGCACCGGGCATCCCAG
CTGACCGTCAGCTCCCTGCAGTGCCATAGACATAAGCCATGGCGCCTCGGACCCAGATTT
ATGAACCTGATCAAAGAGGCCCGGTGGGATGGCTTGACTGGGCATATCACCTTTAATAAA
ACCAATGGCTTGAGGAAGGATTTTGATCTGGACATTATTAGTCTCAAAGAGGAAGGAACT
GAAAAGGCTGCTGGCGAAGTGTCTAAACACTTGTATAAAGTGTGGAAGAAGATTGGGATT
TGGAATTCCAACAGTGGGCTTAACATGACGGACAGCAACAAAGACAAGTCCAGCAATATC
ACTGATTCATTGGCCAACAGAACACTCATTGTCACCACCATTCTGGAAGAACCCTATGTT
ATGTACAGGAAATCTGATAAGCCTCTATATGGAAATGACAGATTTGAAGGATATTGCCTA
GACCTGTTGAAAGAATTGTCAAACATCCTGGGTTTCATTTATGATGTTAAACTAGTTCCC
GATGGCAAATATGGGGCCCAGAATGACAAAGGGGAGTGGAACGGGATGGTTAAAGAACTC
ATAGATCACAGGGCTGACCTGGCAGTGGCTCCTCTTACCATCACCTACGTGCGGGAGAAA
GTCATTGACTTCTCCAAACCCTTCATGACCCTAGGCATCAGCATTCTCTACCGGAAGCCC
AATGGTACCAATCCAGGCGTTTTCTCCTTCCTCAACCCCCTGTCTCCAGATATTTGGATG
TATGTGCTCTTAGCCTGCTTGGGAGTCAGCTGTGTACTCTTTGTGATTGCAAGGTTTACA
CCCTACGAGTGGTATAACCCCCACCCATGCAACCCTGACTCAGACGTGGTGGAAAACAAT
TTTACTTTACTAAATAGTTTCTGGTTTGGAGTTGGAGCTCTCATGCAGCAAGGATCAGAG
CTGATGCCCAAAGCTCTATCGACCAGAATAGTTGGAGGGATATGGTGGTTTTTCACCCTA
ATCATCATTTCATCCTACACGGCCAATCTGGCTGCCTTCTTGACAGTAGAGAGAATGGAA
TCCCCCATAGATTCGGCAGATGATCTGGCAAAGCAAACCAAGATAGAATATGGGGCGGTT
AGAGATGGATCAACAATGACCTTCTTCAAGAAATCAAAAATCTCCACCTATGAGAAGATG
TGGGCTTTCATGAGCAGCAGGCAGCAGACCGCCCTGGTAAGAAACAGTGATGAGGGGATC
CAGAGAGTGCTCACCACAGACTACGCGCTGCTGATGGAGTCCACCAGCATTGAGTATGTG
ACGCAGAGAAACTGCAACCTCACTCAGATCGGGGGCCTCATTGACTCCAAAGGTTACGGA
GTGGGAACACCTATTGGTTCTCCTTACCGGGATAAAATTACTATTGCTATTCTTCAACTC
CAAGAAGAAGGGAAGCTGCATATGATGAAAGAGAAGTGGTGGCGTGGGAATGGCTGCCCC
GAGGAAGACAACAAAGAAGCCAGTGCCCTGGGAGTGGAAAATATTGGAGGCATCTTCATT
GTTCTGGCTGCCGGACTGGTCCTTTCTGTATTTGTAGCTATTGGAGAATTCATATACAAA
TCACGGAAGAATAATGATATTGAACAGGCTTTTTGTTTCTTTTATGGACTGCAATGTAAG
CAAACCCATCCAACCAACTCCACTTCTGGAACTACTTTATCTACGGATTTAGAATGTGGT
AAATTAATTCGAGAGGAGAGAGGGATTCGAAAACAGTCCTCAGTTCATACTGTGTAA
GenBank Gene IDL19058
GeneCard IDNot Available
GenAtlas IDGRIK1
HGNC IDHGNC:4579
Chromosome Location21
LocusNot Available
References
  1. Gregor P, O'Hara BF, Yang X, Uhl GR: Expression and novel subunit isoforms of glutamate receptor genes GluR5 and GluR6. Neuroreport. 1993 Sep 30;4(12):1343-6. 8260617
  2. Korczak B, Nutt SL, Fletcher EJ, Hoo KH, Elliott CE, Rampersad V, McWhinnie EA, Kamboj RK: cDNA cloning and functional properties of human glutamate receptor EAA3 (GluR5) in homomeric and heteromeric configuration. Receptors Channels. 1995;3(1):41-9. 8589992
  3. Nutt SL, Kamboj RK: RNA editing of human kainate receptor subunits. Neuroreport. 1994 Dec 20;5(18):2625-9. 7696618
  4. Shibata H, Joo A, Fujii Y, Tani A, Makino C, Hirata N, Kikuta R, Ninomiya H, Tashiro N, Fukumaki Y: Association study of polymorphisms in the GluR5 kainate receptor gene (GRIK1) with schizophrenia. Psychiatr Genet. 2001 Sep;11(3):139-44. 11702055