You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSerine/threonine-protein kinase mTOR
Synonyms
  • 2.7.11.1
  • FK506-binding protein 12-rapamycin complex-associated protein 1
  • FKBP12-rapamycin complex-associated protein
  • FRAP
  • FRAP1
  • FRAP2
  • Mammalian target of rapamycin
  • Mechanistic target of rapamycin
  • mTOR
  • RAFT1
  • Rapamycin and FKBP12 target 1
  • Rapamycin target protein 1
  • RAPT1
Gene NameMTOR
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004687|Serine/threonine-protein kinase mTOR
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
Number of residues2549
Molecular Weight288889.05
Theoretical pI7.17
GO Classification
Functions
  • RNA polymerase III type 3 promoter DNA binding
  • protein dimerization activity
  • TFIIIC-class transcription factor binding
  • phosphoprotein binding
  • drug binding
  • ribosome binding
  • ATP binding
  • RNA polymerase III type 1 promoter DNA binding
  • kinase activity
  • RNA polymerase III type 2 promoter DNA binding
  • protein serine/threonine kinase activity
Processes
  • epidermal growth factor receptor signaling pathway
  • ruffle organization
  • positive regulation of oligodendrocyte differentiation
  • TOR signaling
  • innate immune response
  • voluntary musculoskeletal movement
  • positive regulation of peptidyl-tyrosine phosphorylation
  • cardiac muscle cell development
  • negative regulation of autophagy
  • cardiac muscle contraction
  • positive regulation of protein phosphorylation
  • heart valve morphogenesis
  • growth
  • cellular response to heat
  • phosphatidylinositol-mediated signaling
  • regulation of actin cytoskeleton organization
  • negative regulation of cell size
  • cell growth
  • regulation of cellular response to heat
  • protein autophosphorylation
  • Fc-epsilon receptor signaling pathway
  • negative regulation of mitophagy
  • cell cycle arrest
  • regulation of myelination
  • multicellular organism growth
  • negative regulation of NFAT protein import into nucleus
  • phosphorylation
  • positive regulation of actin filament polymerization
  • post-embryonic development
  • positive regulation of lamellipodium assembly
  • response to stress
  • positive regulation of lipid biosynthetic process
  • cellular response to hypoxia
  • peptidyl-serine phosphorylation
  • fibroblast growth factor receptor signaling pathway
  • positive regulation of myotube differentiation
  • positive regulation of stress fiber assembly
  • response to amino acid
  • 'de novo' pyrimidine nucleobase biosynthetic process
  • insulin receptor signaling pathway
  • positive regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter
  • regulation of protein kinase activity
  • response to nutrient
  • macroautophagy
  • positive regulation of protein kinase B signaling
  • neurotrophin TRK receptor signaling pathway
  • regulation of carbohydrate utilization
  • regulation of GTPase activity
  • positive regulation of gene expression
  • protein catabolic process
  • protein phosphorylation
  • regulation of fatty acid beta-oxidation
  • gene expression
  • germ cell development
  • signal transduction
  • positive regulation of transcription from RNA polymerase III promoter
  • vascular endothelial growth factor receptor signaling pathway
  • regulation of glycogen biosynthetic process
  • transcription initiation from RNA polymerase II promoter
  • peptidyl-threonine phosphorylation
  • positive regulation of translation
  • regulation of membrane permeability
  • T cell costimulation
  • cellular response to nutrient levels
  • regulation of osteoclast differentiation
  • double-strand break repair via homologous recombination
  • positive regulation of endothelial cell proliferation
  • heart morphogenesis
  • energy reserve metabolic process
  • regulation of response to food
Components
  • endoplasmic reticulum membrane
  • lysosomal membrane
  • lysosome
  • PML body
  • neuronal cell body
  • mitochondrial outer membrane
  • cytoplasm
  • phosphatidylinositol 3-kinase complex
  • endomembrane system
  • membrane
  • TORC1 complex
  • TORC2 complex
  • Golgi membrane
  • cytosol
  • nucleoplasm
  • dendrite
General FunctionTfiiic-class transcription factor binding
Specific FunctionSerine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals. MTOR directly or indirectly regulates the phosphorylation of at least 800 proteins. Functions as part of 2 structurally and functionally distinct signaling complexes mTORC1 and mTORC2 (mTOR complex 1 and 2). Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. This includes phosphorylation of EIF4EBP1 and release of its inhibition toward the elongation initiation factor 4E (eiF4E). Moreover, phosphorylates and activates RPS6KB1 and RPS6KB2 that promote protein synthesis by modulating the activity of their downstream targets including ribosomal protein S6, eukaryotic translation initiation factor EIF4B, and the inhibitor of translation initiation PDCD4. Stimulates the pyrimidine biosynthesis pathway, both by acute regulation through RPS6KB1-mediated phosphorylation of the biosynthetic enzyme CAD, and delayed regulation, through transcriptional enhancement of the pentose phosphate pathway which produces 5-phosphoribosyl-1-pyrophosphate (PRPP), an allosteric activator of CAD at a later step in synthesis, this function is dependent on the mTORC1 complex. Regulates ribosome synthesis by activating RNA polymerase III-dependent transcription through phosphorylation and inhibition of MAF1 an RNA polymerase III-repressor. In parallel to protein synthesis, also regulates lipid synthesis through SREBF1/SREBP1 and LPIN1. To maintain energy homeostasis mTORC1 may also regulate mitochondrial biogenesis through regulation of PPARGC1A. mTORC1 also negatively regulates autophagy through phosphorylation of ULK1. Under nutrient sufficiency, phosphorylates ULK1 at 'Ser-758', disrupting the interaction with AMPK and preventing activation of ULK1. Also prevents autophagy through phosphorylation of the autophagy inhibitor DAP. mTORC1 exerts a feedback control on upstream growth factor signaling that includes phosphorylation and activation of GRB10 a INSR-dependent signaling suppressor. Among other potential targets mTORC1 may phosphorylate CLIP1 and regulate microtubules. As part of the mTORC2 complex MTOR may regulate other cellular processes including survival and organization of the cytoskeleton. Plays a critical role in the phosphorylation at 'Ser-473' of AKT1, a pro-survival effector of phosphoinositide 3-kinase, facilitating its activation by PDK1. mTORC2 may regulate the actin cytoskeleton, through phosphorylation of PRKCA, PXN and activation of the Rho-type guanine nucleotide exchange factors RHOA and RAC1A or RAC1B. mTORC2 also regulates the phosphorylation of SGK1 at 'Ser-422'. Regulates osteoclastogensis by adjusting the expression of CEBPB isoforms (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP42345
UniProtKB Entry NameMTOR_HUMAN
Cellular LocationEndoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0011711|Serine/threonine-protein kinase mTOR (MTOR)
ATGCTTGGAACCGGACCTGCCGCCGCCACCACCGCTGCCACCACATCTAGCAATGTGAGC
GTCCTGCAGCAGTTTGCCAGTGGCCTAAAGAGCCGGAATGAGGAAACCAGGGCCAAAGCC
GCCAAGGAGCTCCAGCACTATGTCACCATGGAACTCCGAGAGATGAGTCAAGAGGAGTCT
ACTCGCTTCTATGACCAACTGAACCATCACATTTTTGAATTGGTTTCCAGCTCAGATGCC
AATGAGAGGAAAGGTGGCATCTTGGCCATAGCTAGCCTCATAGGAGTGGAAGGTGGGAAT
GCCACCCGAATTGGCAGATTTGCCAACTATCTTCGGAACCTCCTCCCCTCCAATGACCCA
GTTGTCATGGAAATGGCATCCAAGGCCATTGGCCGTCTTGCCATGGCAGGGGACACTTTT
ACCGCTGAGTACGTGGAATTTGAGGTGAAGCGAGCCCTGGAATGGCTGGGTGCTGACCGC
AATGAGGGCCGGAGACATGCAGCTGTCCTGGTTCTCCGTGAGCTGGCCATCAGCGTCCCT
ACCTTCTTCTTCCAGCAAGTGCAACCCTTCTTTGACAACATTTTTGTGGCCGTGTGGGAC
CCCAAACAGGCCATCCGTGAGGGAGCTGTAGCCGCCCTTCGTGCCTGTCTGATTCTCACA
ACCCAGCGTGAGCCGAAGGAGATGCAGAAGCCTCAGTGGTACAGGCACACATTTGAAGAA
GCAGAGAAGGGATTTGATGAGACCTTGGCCAAAGAGAAGGGCATGAATCGGGATGATCGG
ATCCATGGAGCCTTGTTGATCCTTAACGAGCTGGTCCGAATCAGCAGCATGGAGGGAGAG
CGTCTGAGAGAAGAAATGGAAGAAATCACACAGCAGCAGCTGGTACACGACAAGTACTGC
AAAGATCTCATGGGCTTCGGAACAAAACCTCGTCACATTACCCCCTTCACCAGTTTCCAG
GCTGTACAGCCCCAGCAGTCAAATGCCTTGGTGGGGCTGCTGGGGTACAGCTCTCACCAA
GGCCTCATGGGATTTGGGACCTCCCCCAGTCCAGCTAAGTCCACCCTGGTGGAGAGCCGG
TGTTGCAGAGACTTGATGGAGGAGAAATTTGATCAGGTGTGCCAGTGGGTGCTGAAATGC
AGGAATAGCAAGAACTCGCTGATCCAAATGACAATCCTTAATTTGTTGCCCCGCTTGGCT
GCATTCCGACCTTCTGCCTTCACAGATACCCAGTATCTCCAAGATACCATGAACCATGTC
CTAAGCTGTGTCAAGAAGGAGAAGGAACGTACAGCGGCCTTCCAAGCCCTGGGGCTACTT
TCTGTGGCTGTGAGGTCTGAGTTTAAGGTCTATTTGCCTCGCGTGCTGGACATCATCCGA
GCGGCCCTGCCCCCAAAGGACTTCGCCCATAAGAGGCAGAAGGCAATGCAGGTGGATGCC
ACAGTCTTCACTTGCATCAGCATGCTGGCTCGAGCAATGGGGCCAGGCATCCAGCAGGAT
ATCAAGGAGCTGCTGGAGCCCATGCTGGCAGTGGGACTAAGCCCTGCCCTCACTGCAGTG
CTCTACGACCTGAGCCGTCAGATTCCACAGCTAAAGAAGGACATTCAAGATGGGCTACTG
AAAATGCTGTCCCTGGTCCTTATGCACAAACCCCTTCGCCACCCAGGCATGCCCAAGGGC
CTGGCCCATCAGCTGGCCTCTCCTGGCCTCACGACCCTCCCTGAGGCCAGCGATGTGGGC
AGCATCACTCTTGCCCTCCGAACGCTTGGCAGCTTTGAATTTGAAGGCCACTCTCTGACC
CAATTTGTTCGCCACTGTGCGGATCATTTCCTGAACAGTGAGCACAAGGAGATCCGCATG
GAGGCTGCCCGCACCTGCTCCCGCCTGCTCACACCCTCCATCCACCTCATCAGTGGCCAT
GCTCATGTGGTTAGCCAGACCGCAGTGCAAGTGGTGGCAGATGTGCTTAGCAAACTGCTC
GTAGTTGGGATAACAGATCCTGACCCTGACATTCGCTACTGTGTCTTGGCGTCCCTGGAC
GAGCGCTTTGATGCACACCTGGCCCAGGCGGAGAACTTGCAGGCCTTGTTTGTGGCTCTG
AATGACCAGGTGTTTGAGATCCGGGAGCTGGCCATCTGCACTGTGGGCCGACTCAGTAGC
ATGAACCCTGCCTTTGTCATGCCTTTCCTGCGCAAGATGCTCATCCAGATTTTGACAGAG
TTGGAGCACAGTGGGATTGGAAGAATCAAAGAGCAGAGTGCCCGCATGCTGGGGCACCTG
GTCTCCAATGCCCCCCGACTCATCCGCCCCTACATGGAGCCTATTCTGAAGGCATTAATT
TTGAAACTGAAAGATCCAGACCCTGATCCAAACCCAGGTGTGATCAATAATGTCCTGGCA
ACAATAGGAGAATTGGCACAGGTTAGTGGCCTGGAAATGAGGAAATGGGTTGATGAACTT
TTTATTATCATCATGGACATGCTCCAGGATTCCTCTTTGTTGGCCAAAAGGCAGGTGGCT
CTGTGGACCCTGGGACAGTTGGTGGCCAGCACTGGCTATGTAGTAGAGCCCTACAGGAAG
TACCCTACTTTGCTTGAGGTGCTACTGAATTTTCTGAAGACTGAGCAGAACCAGGGTACA
CGCAGAGAGGCCATCCGTGTGTTAGGGCTTTTAGGGGCTTTGGATCCTTACAAGCACAAA
GTGAACATTGGCATGATAGACCAGTCCCGGGATGCCTCTGCTGTCAGCCTGTCAGAATCC
AAGTCAAGTCAGGATTCCTCTGACTATAGCACTAGTGAAATGCTGGTCAACATGGGAAAC
TTGCCTCTGGATGAGTTCTACCCAGCTGTGTCCATGGTGGCCCTGATGCGGATCTTCCGA
GACCAGTCACTCTCTCATCATCACACCATGGTTGTCCAGGCCATCACCTTCATCTTCAAG
TCCCTGGGACTCAAATGTGTGCAGTTCCTGCCCCAGGTCATGCCCACGTTCCTTAACGTC
ATTCGAGTCTGTGATGGGGCCATCCGGGAATTTTTGTTCCAGCAGCTGGGAATGTTGGTG
TCCTTTGTGAAGAGCCACATCAGACCTTATATGGATGAAATAGTCACCCTCATGAGAGAA
TTCTGGGTCATGAACACCTCAATTCAGAGCACGATCATTCTTCTCATTGAGCAAATTGTG
GTAGCTCTTGGGGGTGAATTTAAGCTCTACCTGCCCCAGCTGATCCCACACATGCTGCGT
GTCTTCATGCATGACAACAGCCCAGGCCGCATTGTCTCTATCAAGTTACTGGCTGCAATC
CAGCTGTTTGGCGCCAACCTGGATGACTACCTGCATTTACTGCTGCCTCCTATTGTTAAG
TTGTTTGATGCCCCTGAAGCTCCACTGCCATCTCGAAAGGCAGCGCTAGAGACTGTGGAC
CGCCTGACGGAGTCCCTGGATTTCACTGACTATGCCTCCCGGATCATTCACCCTATTGTT
CGAACACTGGACCAGAGCCCAGAACTGCGCTCCACAGCCATGGACACGCTGTCTTCACTT
GTTTTTCAGCTGGGGAAGAAGTACCAAATTTTCATTCCAATGGTGAATAAAGTTCTGGTG
CGACACCGAATCAATCATCAGCGCTATGATGTGCTCATCTGCAGAATTGTCAAGGGATAC
ACACTTGCTGATGAAGAGGAGGATCCTTTGATTTACCAGCATCGGATGCTTAGGAGTGGC
CAAGGGGATGCATTGGCTAGTGGACCAGTGGAAACAGGACCCATGAAGAAACTGCACGTC
AGCACCATCAACCTCCAAAAGGCCTGGGGCGCTGCCAGGAGGGTCTCCAAAGATGACTGG
CTGGAATGGCTGAGACGGCTGAGCCTGGAGCTGCTGAAGGACTCATCATCGCCCTCCCTG
CGCTCCTGCTGGGCCCTGGCACAGGCCTACAACCCGATGGCCAGGGATCTCTTCAATGCT
GCATTTGTGTCCTGCTGGTCTGAACTGAATGAAGATCAACAGGATGAGCTCATCAGAAGC
ATCGAGTTGGCCCTCACCTCACAAGACATCGCTGAAGTCACACAGACCCTCTTAAACTTG
GCTGAATTCATGGAACACAGTGACAAGGGCCCCCTGCCACTGAGAGATGACAATGGCATT
GTTCTGCTGGGTGAGAGAGCTGCCAAGTGCCGAGCATATGCCAAAGCACTACACTACAAA
GAACTGGAGTTCCAGAAAGGCCCCACCCCTGCCATTCTAGAATCTCTCATCAGCATTAAT
AATAAGCTACAGCAGCCGGAGGCAGCGGCCGGAGTGTTAGAATATGCCATGAAACACTTT
GGAGAGCTGGAGATCCAGGCTACCTGGTATGAGAAACTGCACGAGTGGGAGGATGCCCTT
GTGGCCTATGACAAGAAAATGGACACCAACAAGGACGACCCAGAGCTGATGCTGGGCCGC
ATGCGCTGCCTCGAGGCCTTGGGGGAATGGGGTCAACTCCACCAGCAGTGCTGTGAAAAG
TGGACCCTGGTTAATGATGAGACCCAAGCCAAGATGGCCCGGATGGCTGCTGCAGCTGCA
TGGGGTTTAGGTCAGTGGGACAGCATGGAAGAATACACCTGTATGATCCCTCGGGACACC
CATGATGGGGCATTTTATAGAGCTGTGCTGGCACTGCATCAGGACCTCTTCTCCTTGGCA
CAACAGTGCATTGACAAGGCCAGGGACCTGCTGGATGCTGAATTAACTGCGATGGCAGGA
GAGAGTTACAGTCGGGCATATGGGGCCATGGTTTCTTGCCACATGCTGTCCGAGCTGGAG
GAGGTTATCCAGTACAAACTTGTCCCCGAGCGACGAGAGATCATCCGCCAGATCTGGTGG
GAGAGACTGCAGGGCTGCCAGCGTATCGTAGAGGACTGGCAGAAAATCCTTATGGTGCGG
TCCCTTGTGGTCAGCCCTCATGAAGACATGAGAACCTGGCTCAAGTATGCAAGCCTGTGC
GGCAAGAGTGGCAGGCTGGCTCTTGCTCATAAAACTTTAGTGTTGCTCCTGGGAGTTGAT
CCGTCTCGGCAACTTGACCATCCTCTGCCAACAGTTCACCCTCAGGTGACCTATGCCTAC
ATGAAAAACATGTGGAAGAGTGCCCGCAAGATCGATGCCTTCCAGCACATGCAGCATTTT
GTCCAGACCATGCAGCAACAGGCCCAGCATGCCATCGCTACTGAGGACCAGCAGCATAAG
CAGGAACTGCACAAGCTCATGGCCCGATGCTTCCTGAAACTTGGAGAGTGGCAGCTGAAT
CTACAGGGCATCAATGAGAGCACAATCCCCAAAGTGCTGCAGTACTACAGCGCCGCCACA
GAGCACGACCGCAGCTGGTACAAGGCCTGGCATGCGTGGGCAGTGATGAACTTCGAAGCT
GTGCTACACTACAAACATCAGAACCAAGCCCGCGATGAGAAGAAGAAACTGCGTCATGCC
AGCGGGGCCAACATCACCAACGCCACCACTGCCGCCACCACGGCCGCCACTGCCACCACC
ACTGCCAGCACCGAGGGCAGCAACAGTGAGAGCGAGGCCGAGAGCACCGAGAACAGCCCC
ACCCCATCGCCGCTGCAGAAGAAGGTCACTGAGGATCTGTCCAAAACCCTCCTGATGTAC
ACGGTGCCTGCCGTCCAGGGCTTCTTCCGTTCCATCTCCTTGTCACGAGGCAACAACCTC
CAGGATACACTCAGAGTTCTCACCTTATGGTTTGATTATGGTCACTGGCCAGATGTCAAT
GAGGCCTTAGTGGAGGGGGTGAAAGCCATCCAGATTGATACCTGGCTACAGGTTATACCT
CAGCTCATTGCAAGAATTGATACGCCCAGACCCTTGGTGGGACGTCTCATTCACCAGCTT
CTCACAGACATTGGTCGGTACCACCCCCAGGCCCTCATCTACCCACTGACAGTGGCTTCT
AAGTCTACCACGACAGCCCGGCACAATGCAGCCAACAAGATTCTGAAGAACATGTGTGAG
CACAGCAACACCCTGGTCCAGCAGGCCATGATGGTGAGCGAGGAGCTGATCCGAGTGGCC
ATCCTCTGGCATGAGATGTGGCATGAAGGCCTGGAAGAGGCATCTCGTTTGTACTTTGGG
GAAAGGAACGTGAAAGGCATGTTTGAGGTGCTGGAGCCCTTGCATGCTATGATGGAACGG
GGCCCCCAGACTCTGAAGGAAACATCCTTTAATCAGGCCTATGGTCGAGATTTAATGGAG
GCCCAAGAGTGGTGCAGGAAGTACATGAAATCAGGGAATGTCAAGGACCTCACCCAAGCC
TGGGACCTCTATTATCATGTGTTCCGACGAATCTCAAAGCAGCTGCCTCAGCTCACATCC
TTAGAGCTGCAATATGTTTCCCCAAAACTTCTGATGTGCCGGGACCTTGAATTGGCTGTG
CCAGGAACATATGACCCCAACCAGCCAATCATTCGCATTCAGTCCATAGCACCGTCTTTG
CAAGTCATCACATCCAAGCAGAGGCCCCGGAAATTGACACTTATGGGCAGCAACGGACAT
GAGTTTGTTTTCCTTCTAAAAGGCCATGAAGATCTGCGCCAGGATGAGCGTGTGATGCAG
CTCTTCGGCCTGGTTAACACCCTTCTGGCCAATGACCCAACATCTCTTCGGAAAAACCTC
AGCATCCAGAGATACGCTGTCATCCCTTTATCGACCAACTCGGGCCTCATTGGCTGGGTT
CCCCACTGTGACACACTGCACGCCCTCATCCGGGACTACAGGGAGAAGAAGAAGATCCTT
CTCAACATCGAGCATCGCATCATGTTGCGGATGGCTCCGGACTATGACCACTTGACTCTG
ATGCAGAAGGTGGAGGTGTTTGAGCATGCCGTCAATAATACAGCTGGGGACGACCTGGCC
AAGCTGCTGTGGCTGAAAAGCCCCAGCTCCGAGGTGTGGTTTGACCGAAGAACCAATTAT
ACCCGTTCTTTAGCGGTCATGTCAATGGTTGGGTATATTTTAGGCCTGGGAGATAGACAC
CCATCCAACCTGATGCTGGACCGTCTGAGTGGGAAGATCCTGCACATTGACTTTGGGGAC
TGCTTTGAGGTTGCTATGACCCGAGAGAAGTTTCCAGAGAAGATTCCATTTAGACTAACA
AGAATGTTGACCAATGCTATGGAGGTTACAGGCCTGGATGGCAACTACAGAATCACATGC
CACACAGTGATGGAGGTGCTGCGAGAGCACAAGGACAGTGTCATGGCCGTGCTGGAAGCC
TTTGTCTATGACCCCTTGCTGAACTGGAGGCTGATGGACACAAATACCAAAGGCAACAAG
CGATCCCGAACGAGGACGGATTCCTACTCTGCTGGCCAGTCAGTCGAAATTTTGGACGGT
GTGGAACTTGGAGAGCCAGCCCATAAGAAAACGGGGACCACAGTGCCAGAATCTATTCAT
TCTTTCATTGGAGACGGTTTGGTGAAACCAGAGGCCCTAAATAAGAAAGCTATCCAGATT
ATTAACAGGGTTCGAGATAAGCTCACTGGTCGGGACTTCTCTCATGATGACACTTTGGAT
GTTCCAACGCAAGTTGAGCTGCTCATCAAACAAGCGACATCCCATGAAAACCTCTGCCAG
TGCTATATTGGCTGGTGCCCTTTCTGGTAA
GenBank Gene IDL34075
GeneCard IDNot Available
GenAtlas IDFRAP1
HGNC IDHGNC:3942
Chromosome Location1
Locus1p36.2
References
  1. Brown EJ, Albers MW, Shin TB, Ichikawa K, Keith CT, Lane WS, Schreiber SL: A mammalian protein targeted by G1-arresting rapamycin-receptor complex. Nature. 1994 Jun 30;369(6483):756-8. 8008069
  2. Onyango P, Lubyova B, Gardellin P, Kurzbauer R, Weith A: Molecular cloning and expression analysis of five novel genes in chromosome 1p36. Genomics. 1998 Jun 1;50(2):187-98. 9653645
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Stover C, Endo Y, Takahashi M, Lynch NJ, Constantinescu C, Vorup-Jensen T, Thiel S, Friedl H, Hankeln T, Hall R, Gregory S, Fujita T, Schwaeble W: The human gene for mannan-binding lectin-associated serine protease-2 (MASP-2), the effector component of the lectin route of complement activation, is part of a tightly linked gene cluster on chromosome 1p36.2-3. Genes Immun. 2001 May;2(3):119-27. 11426320
  6. Chiu MI, Katz H, Berlin V: RAPT1, a mammalian homolog of yeast Tor, interacts with the FKBP12/rapamycin complex. Proc Natl Acad Sci U S A. 1994 Dec 20;91(26):12574-8. 7809080
  7. Withers DJ, Ouwens DM, Nave BT, van der Zon GC, Alarcon CM, Cardenas ME, Heitman J, Maassen JA, Shepherd PR: Expression, enzyme activity, and subcellular localization of mammalian target of rapamycin in insulin-responsive cells. Biochem Biophys Res Commun. 1997 Dec 29;241(3):704-9. 9434772
  8. Wu S, Mikhailov A, Kallo-Hosein H, Hara K, Yonezawa K, Avruch J: Characterization of ubiquilin 1, an mTOR-interacting protein. Biochim Biophys Acta. 2002 Jan 30;1542(1-3):41-56. 11853878
  9. Kim DH, Sarbassov DD, Ali SM, King JE, Latek RR, Erdjument-Bromage H, Tempst P, Sabatini DM: mTOR interacts with raptor to form a nutrient-sensitive complex that signals to the cell growth machinery. Cell. 2002 Jul 26;110(2):163-75. 12150925
  10. Hara K, Maruki Y, Long X, Yoshino K, Oshiro N, Hidayat S, Tokunaga C, Avruch J, Yonezawa K: Raptor, a binding partner of target of rapamycin (TOR), mediates TOR action. Cell. 2002 Jul 26;110(2):177-89. 12150926
  11. Choi JH, Bertram PG, Drenan R, Carvalho J, Zhou HH, Zheng XF: The FKBP12-rapamycin-associated protein (FRAP) is a CLIP-170 kinase. EMBO Rep. 2002 Oct;3(10):988-94. Epub 2002 Sep 13. 12231510
  12. Park IH, Bachmann R, Shirazi H, Chen J: Regulation of ribosomal S6 kinase 2 by mammalian target of rapamycin. J Biol Chem. 2002 Aug 30;277(35):31423-9. Epub 2002 Jun 26. 12087098
  13. Loewith R, Jacinto E, Wullschleger S, Lorberg A, Crespo JL, Bonenfant D, Oppliger W, Jenoe P, Hall MN: Two TOR complexes, only one of which is rapamycin sensitive, have distinct roles in cell growth control. Mol Cell. 2002 Sep;10(3):457-68. 12408816
  14. Desai BN, Myers BR, Schreiber SL: FKBP12-rapamycin-associated protein associates with mitochondria and senses osmotic stress via mitochondrial dysfunction. Proc Natl Acad Sci U S A. 2002 Apr 2;99(7):4319-24. 11930000
  15. Inoki K, Zhu T, Guan KL: TSC2 mediates cellular energy response to control cell growth and survival. Cell. 2003 Nov 26;115(5):577-90. 14651849
  16. Kim DH, Sarbassov DD, Ali SM, Latek RR, Guntur KV, Erdjument-Bromage H, Tempst P, Sabatini DM: GbetaL, a positive regulator of the rapamycin-sensitive pathway required for the nutrient-sensitive interaction between raptor and mTOR. Mol Cell. 2003 Apr;11(4):895-904. 12718876
  17. Sarbassov DD, Ali SM, Kim DH, Guertin DA, Latek RR, Erdjument-Bromage H, Tempst P, Sabatini DM: Rictor, a novel binding partner of mTOR, defines a rapamycin-insensitive and raptor-independent pathway that regulates the cytoskeleton. Curr Biol. 2004 Jul 27;14(14):1296-302. 15268862
  18. Brugarolas J, Lei K, Hurley RL, Manning BD, Reiling JH, Hafen E, Witters LA, Ellisen LW, Kaelin WG Jr: Regulation of mTOR function in response to hypoxia by REDD1 and the TSC1/TSC2 tumor suppressor complex. Genes Dev. 2004 Dec 1;18(23):2893-904. Epub 2004 Nov 15. 15545625
  19. Drenan RM, Liu X, Bertram PG, Zheng XF: FKBP12-rapamycin-associated protein or mammalian target of rapamycin (FRAP/mTOR) localization in the endoplasmic reticulum and the Golgi apparatus. J Biol Chem. 2004 Jan 2;279(1):772-8. Epub 2003 Oct 24. 14578359
  20. Jacinto E, Loewith R, Schmidt A, Lin S, Ruegg MA, Hall A, Hall MN: Mammalian TOR complex 2 controls the actin cytoskeleton and is rapamycin insensitive. Nat Cell Biol. 2004 Nov;6(11):1122-8. Epub 2004 Oct 3. 15467718
  21. Holz MK, Blenis J: Identification of S6 kinase 1 as a novel mammalian target of rapamycin (mTOR)-phosphorylating kinase. J Biol Chem. 2005 Jul 15;280(28):26089-93. Epub 2005 May 19. 15905173
  22. Sarbassov DD, Guertin DA, Ali SM, Sabatini DM: Phosphorylation and regulation of Akt/PKB by the rictor-mTOR complex. Science. 2005 Feb 18;307(5712):1098-101. 15718470
  23. Woo SY, Kim DH, Jun CB, Kim YM, Haar EV, Lee SI, Hegg JW, Bandhakavi S, Griffin TJ, Kim DH: PRR5, a novel component of mTOR complex 2, regulates platelet-derived growth factor receptor beta expression and signaling. J Biol Chem. 2007 Aug 31;282(35):25604-12. Epub 2007 Jun 28. 17599906
  24. Sancak Y, Thoreen CC, Peterson TR, Lindquist RA, Kang SA, Spooner E, Carr SA, Sabatini DM: PRAS40 is an insulin-regulated inhibitor of the mTORC1 protein kinase. Mol Cell. 2007 Mar 23;25(6):903-15. 17386266
  25. Garcia-Martinez JM, Alessi DR: mTOR complex 2 (mTORC2) controls hydrophobic motif phosphorylation and activation of serum- and glucocorticoid-induced protein kinase 1 (SGK1). Biochem J. 2008 Dec 15;416(3):375-85. doi: 10.1042/BJ20081668. 18925875
  26. Porstmann T, Santos CR, Griffiths B, Cully M, Wu M, Leevers S, Griffiths JR, Chung YL, Schulze A: SREBP activity is regulated by mTORC1 and contributes to Akt-dependent cell growth. Cell Metab. 2008 Sep;8(3):224-36. doi: 10.1016/j.cmet.2008.07.007. 18762023
  27. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  28. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  29. Sancak Y, Peterson TR, Shaul YD, Lindquist RA, Thoreen CC, Bar-Peled L, Sabatini DM: The Rag GTPases bind raptor and mediate amino acid signaling to mTORC1. Science. 2008 Jun 13;320(5882):1496-501. doi: 10.1126/science.1157535. Epub 2008 May 22. 18497260
  30. Peterson TR, Laplante M, Thoreen CC, Sancak Y, Kang SA, Kuehl WM, Gray NS, Sabatini DM: DEPTOR is an mTOR inhibitor frequently overexpressed in multiple myeloma cells and required for their survival. Cell. 2009 May 29;137(5):873-86. doi: 10.1016/j.cell.2009.03.046. Epub 2009 May 14. 19446321
  31. Acosta-Jaquez HA, Keller JA, Foster KG, Ekim B, Soliman GA, Feener EP, Ballif BA, Fingar DC: Site-specific mTOR phosphorylation promotes mTORC1-mediated signaling and cell growth. Mol Cell Biol. 2009 Aug;29(15):4308-24. doi: 10.1128/MCB.01665-08. Epub 2009 Jun 1. 19487463
  32. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  33. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  34. Rosner M, Siegel N, Valli A, Fuchs C, Hengstschlager M: mTOR phosphorylated at S2448 binds to raptor and rictor. Amino Acids. 2010 Jan;38(1):223-8. doi: 10.1007/s00726-008-0230-7. Epub 2009 Jan 15. 19145465
  35. Sancak Y, Bar-Peled L, Zoncu R, Markhard AL, Nada S, Sabatini DM: Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids. Cell. 2010 Apr 16;141(2):290-303. doi: 10.1016/j.cell.2010.02.024. Epub 2010 Apr 8. 20381137
  36. Koren I, Reem E, Kimchi A: DAP1, a novel substrate of mTOR, negatively regulates autophagy. Curr Biol. 2010 Jun 22;20(12):1093-8. doi: 10.1016/j.cub.2010.04.041. Epub 2010 May 27. 20537536
  37. Hurov KE, Cotta-Ramusino C, Elledge SJ: A genetic screen identifies the Triple T complex required for DNA damage signaling and ATM and ATR stability. Genes Dev. 2010 Sep 1;24(17):1939-50. doi: 10.1101/gad.1934210. 20810650
  38. Takai H, Xie Y, de Lange T, Pavletich NP: Tel2 structure and function in the Hsp90-dependent maturation of mTOR and ATR complexes. Genes Dev. 2010 Sep 15;24(18):2019-30. doi: 10.1101/gad.1956410. Epub 2010 Aug 27. 20801936
  39. Kaizuka T, Hara T, Oshiro N, Kikkawa U, Yonezawa K, Takehana K, Iemura S, Natsume T, Mizushima N: Tti1 and Tel2 are critical factors in mammalian target of rapamycin complex assembly. J Biol Chem. 2010 Jun 25;285(26):20109-16. doi: 10.1074/jbc.M110.121699. Epub 2010 Apr 28. 20427287
  40. Michels AA, Robitaille AM, Buczynski-Ruchonnet D, Hodroj W, Reina JH, Hall MN, Hernandez N: mTORC1 directly phosphorylates and regulates human MAF1. Mol Cell Biol. 2010 Aug;30(15):3749-57. doi: 10.1128/MCB.00319-10. Epub 2010 Jun 1. 20516213
  41. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  42. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  43. Ekim B, Magnuson B, Acosta-Jaquez HA, Keller JA, Feener EP, Fingar DC: mTOR kinase domain phosphorylation promotes mTORC1 signaling, cell growth, and cell cycle progression. Mol Cell Biol. 2011 Jul;31(14):2787-801. doi: 10.1128/MCB.05437-11. Epub 2011 May 16. 21576368
  44. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  45. Hsu PP, Kang SA, Rameseder J, Zhang Y, Ottina KA, Lim D, Peterson TR, Choi Y, Gray NS, Yaffe MB, Marto JA, Sabatini DM: The mTOR-regulated phosphoproteome reveals a mechanism of mTORC1-mediated inhibition of growth factor signaling. Science. 2011 Jun 10;332(6035):1317-22. doi: 10.1126/science.1199498. 21659604
  46. Meffre J, Chaumont-Dubel S, Mannoury la Cour C, Loiseau F, Watson DJ, Dekeyne A, Seveno M, Rivet JM, Gaven F, Deleris P, Herve D, Fone KC, Bockaert J, Millan MJ, Marin P: 5-HT(6) receptor recruitment of mTOR as a mechanism for perturbed cognition in schizophrenia. EMBO Mol Med. 2012 Oct;4(10):1043-56. doi: 10.1002/emmm.201201410. 23027611
  47. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  48. So EY, Ouchi T: The Potential Role of BRCA1-Associated ATM Activator-1 (BRAT1) in Regulation of mTOR. J Cancer Biol Res. 2013 Jul-Aug;1(1). pii: 1001. 25657994
  49. Halova L, Du W, Kirkham S, Smith DL, Petersen J: Phosphorylation of the TOR ATP binding domain by AGC kinase constitutes a novel mode of TOR inhibition. J Cell Biol. 2013 Nov 25;203(4):595-604. doi: 10.1083/jcb.201305103. Epub 2013 Nov 18. 24247430
  50. Wang JQ, Chen JH, Chen YC, Chen MY, Hsieh CY, Teng SC, Wu KJ: Interaction between NBS1 and the mTOR/Rictor/SIN1 complex through specific domains. PLoS One. 2013 Jun 6;8(6):e65586. doi: 10.1371/journal.pone.0065586. Print 2013. 23762398
  51. Robitaille AM, Christen S, Shimobayashi M, Cornu M, Fava LL, Moes S, Prescianotto-Baschong C, Sauer U, Jenoe P, Hall MN: Quantitative phosphoproteomics reveal mTORC1 activates de novo pyrimidine synthesis. Science. 2013 Mar 15;339(6125):1320-3. doi: 10.1126/science.1228771. Epub 2013 Feb 21. 23429704
  52. Ben-Sahra I, Howell JJ, Asara JM, Manning BD: Stimulation of de novo pyrimidine synthesis by growth signaling through mTOR and S6K1. Science. 2013 Mar 15;339(6125):1323-8. doi: 10.1126/science.1228792. Epub 2013 Feb 21. 23429703
  53. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  54. Rebsamen M, Pochini L, Stasyk T, de Araujo ME, Galluccio M, Kandasamy RK, Snijder B, Fauster A, Rudashevskaya EL, Bruckner M, Scorzoni S, Filipek PA, Huber KV, Bigenzahn JW, Heinz LX, Kraft C, Bennett KL, Indiveri C, Huber LA, Superti-Furga G: SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1. Nature. 2015 Mar 26;519(7544):477-81. doi: 10.1038/nature14107. Epub 2015 Jan 7. 25561175
  55. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  56. Wang S, Tsun ZY, Wolfson RL, Shen K, Wyant GA, Plovanich ME, Yuan ED, Jones TD, Chantranupong L, Comb W, Wang T, Bar-Peled L, Zoncu R, Straub C, Kim C, Park J, Sabatini BL, Sabatini DM: Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science. 2015 Jan 9;347(6218):188-94. doi: 10.1126/science.1257132. Epub 2015 Jan 7. 25567906
  57. Choi J, Chen J, Schreiber SL, Clardy J: Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP. Science. 1996 Jul 12;273(5272):239-42. 8662507
  58. Liang J, Choi J, Clardy J: Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution. Acta Crystallogr D Biol Crystallogr. 1999 Apr;55(Pt 4):736-44. 10089303
  59. Knutson BA: Insights into the domain and repeat architecture of target of rapamycin. J Struct Biol. 2010 May;170(2):354-63. doi: 10.1016/j.jsb.2010.01.002. Epub 2010 Jan 11. 20060908
  60. Yip CK, Murata K, Walz T, Sabatini DM, Kang SA: Structure of the human mTOR complex I and its implications for rapamycin inhibition. Mol Cell. 2010 Jun 11;38(5):768-74. doi: 10.1016/j.molcel.2010.05.017. 20542007
  61. Yang H, Rudge DG, Koos JD, Vaidialingam B, Yang HJ, Pavletich NP: mTOR kinase structure, mechanism and regulation. Nature. 2013 May 9;497(7448):217-23. doi: 10.1038/nature12122. Epub 2013 May 1. 23636326
  62. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. 17344846
  63. Varela I, Tarpey P, Raine K, Huang D, Ong CK, Stephens P, Davies H, Jones D, Lin ML, Teague J, Bignell G, Butler A, Cho J, Dalgliesh GL, Galappaththige D, Greenman C, Hardy C, Jia M, Latimer C, Lau KW, Marshall J, McLaren S, Menzies A, Mudie L, Stebbings L, Largaespada DA, Wessels LF, Richard S, Kahnoski RJ, Anema J, Tuveson DA, Perez-Mancera PA, Mustonen V, Fischer A, Adams DJ, Rust A, Chan-on W, Subimerb C, Dykema K, Furge K, Campbell PJ, Teh BT, Stratton MR, Futreal PA: Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma. Nature. 2011 Jan 27;469(7331):539-42. doi: 10.1038/nature09639. Epub 2011 Jan 19. 21248752