You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameExcitatory amino acid transporter 2
Synonyms
  • EAAT2
  • GLT1
  • Glutamate/aspartate transporter II
  • Sodium-dependent glutamate/aspartate transporter 2
  • Solute carrier family 1 member 2
Gene NameSLC1A2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001762|Excitatory amino acid transporter 2
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Number of residues574
Molecular Weight62103.665
Theoretical pI6.51
GO Classification
Functions
  • L-glutamate transmembrane transporter activity
  • glutamate
  • sodium
Processes
  • transmembrane transport
  • multicellular organism growth
  • response to wounding
  • telencephalon development
  • response to amino acid
  • cellular response to extracellular stimulus
  • ion transport
  • response to drug
  • L-glutamate transmembrane transport
  • adult behavior
  • positive regulation of glucose import
  • synaptic transmission
  • D-aspartate import
  • L-glutamate import
  • glutamate secretion
  • multicellular organismal aging
  • neurotransmitter secretion
  • visual behavior
Components
  • axolemma
  • membrane
  • plasma membrane
  • cell surface
  • integral component of membrane
General FunctionSodium:dicarboxylate symporter activity
Specific FunctionTransports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
Pfam Domain Function
Transmembrane Regions45-64 88-108 121-142 240-259 280-301 317-339 406-430 437-459
GenBank Protein ID487341
UniProtKB IDP43004
UniProtKB Entry NameEAA2_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0019025|Excitatory amino acid transporter 2 (SLC1A2)
ATGCCCAAGCAGGTGGAAGTGCGAATGCACGACAGTCATCTTGGCTCAGAGGAACCCAAG
CACCGGCACCTGGGCCTGCGCCTGTGTGACAAGCTGGGGAAGAATCTGCTGCTCACCCTG
ACGGTGTTTGGTGTCATCCTGGGAGCAGTGTGTGGAGGGCTTCTTCGCTTGGCATCTCCC
ATCCACCCTGATGTGGTTATGTTAATAGCCTTCCCAGGGGATATACTCATGAGGATGCTA
AAAATGCTCATTCTCCCTCTAATCATCTCCAGCTTAATCACAGGGTTGTCAGGCCTGGAT
GCTAAGGCTAGTGGCCGCTTGGGCACGAGAGCCATGGTGTATTACATGTCCACGACCATC
ATTGCTGCAGTACTGGGGGTCATTCTGGTCTTGGCTATCCATCCAGGCAATCCCAAGCTC
AAGAAGCAGCTGGGGCCTGGGAAGAAGAATGATGAAGTGTCCAGCCTGGATGCCTTCCTG
GACCTTATTCGAAATCTCTTCCCTGAAAACCTTGTCCAAGCCTGCTTTCAACAGATTCAA
ACAGTGACGAAGAAAGTCCTGGTTGCACCACCGCCGGACGAGGAGGCCAACGCAACCAGC
GCTGTTGTCTCTCTGTTGAACGAGACTGTGACTGAGGTGCCGGAGGAGACTAAGATGGTT
ATCAAGAAGGGCCTGGAGTTCAAGGATGGGATGAACGTCTTAGGTCTGATAGGGTTTTTC
ATTGCTTTTGGCATCGCTATGGGGAAGATGGGAGATCAGGCCAAGCTGATGGTGGATTTC
TTCAACATTTTGAATGAGATTGTAATGAAGTTAGTGATCATGATCATGTGGTACTCTCCC
CTGGGTATCGCCTGCCTGATCTGTGGAAAGATCATTGCAATCAAGGACTTAGAAGTGGTT
GCTAGGCAACTGGGGATGTACATGGTAACAGTGATCATAGGCCTCATCATCCACGGGGGC
ATCTTTCTCCCCTTGATTTACTTTGTAGTGACCAGGAAAAACCCCTTCTCCTTTTTTGCT
GGCATTTTCCAAGCTTGGATCACTGCCCTGGGCACCGCTTCCAGTGCTGGAACTTTGCCT
GTCACCTTTCGTTGCCTGGAAGAAAATCTGGGGATTGATAAGCGTGTGACTAGATTCGTC
CTTCCTGTTGGAGCAACCATTAACATGGATGGTACAGCCCTTTATGAAGCGGTAGCCGCC
ATCTTTATAGCCCAAATGAATGGTGTTGTCCTGGATGGAGGACAGATTGTGACTGTAAGC
CTCACAGCCACCCTGGCAAGCGTCGGCGCGGCCAGTATCCCCAGTGCCGGGCTGGTCACC
ATGCTCCTCATTCTGACAGCCGTGGGCCTGCCAACAGAGGACATCAGCCTGCTGGTGGCT
GTGGACTGGCTGCTGGACAGGATGAGAACTTCAGTCAATGTTGTGGGTGACTCTTTTGGG
GCTGGGATAGTCTATCACCTCTCCAAGTCTGAGCTGGATACCATTGACTCCCAGCATCGA
GTGCATGAAGATATTGAAATGACCAAGACTCAATCCATTTATGATGACATGAAGAACCAC
AGGGAAAGCAACTCTAATCAATGTGTCTATGCTGCACACAACTCTGTCATAGTAGATGAA
TGCAAGGTAACTCTGGCAGCCAATGGAAAGTCAGCCGACTGCAGTGTTGAGGAAGAACCT
TGGAAACGTGAGAAATAA
GenBank Gene IDU03505
GeneCard IDNot Available
GenAtlas IDSLC1A2
HGNC IDHGNC:10940
Chromosome Location11
Locus11p13-p12
References
  1. Arriza JL, Fairman WA, Wadiche JI, Murdoch GH, Kavanaugh MP, Amara SG: Functional comparisons of three glutamate transporter subtypes cloned from human motor cortex. J Neurosci. 1994 Sep;14(9):5559-69. 7521911
  2. Shashidharan P, Wittenberg I, Plaitakis A: Molecular cloning of human brain glutamate/aspartate transporter II. Biochim Biophys Acta. 1994 May 11;1191(2):393-6. 8172925
  3. Manfras BJ, Rudert WA, Trucco M, Boehm BO: Cloning and characterization of a glutamate transporter cDNA from human brain and pancreas. Biochim Biophys Acta. 1994 Oct 12;1195(1):185-8. 7522567
  4. Shimamoto K, Lebrun B, Yasuda-Kamatani Y, Sakaitani M, Shigeri Y, Yumoto N, Nakajima T: DL-threo-beta-benzyloxyaspartate, a potent blocker of excitatory amino acid transporters. Mol Pharmacol. 1998 Feb;53(2):195-201. 9463476
  5. Kim SY, Chao W, Choi SY, Volsky DJ: Cloning and characterization of the 3'-untranslated region of the human excitatory amino acid transporter 2 transcript. J Neurochem. 2003 Sep;86(6):1458-67. 12950454
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  7. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  9. Gendreau S, Voswinkel S, Torres-Salazar D, Lang N, Heidtmann H, Detro-Dassen S, Schmalzing G, Hidalgo P, Fahlke C: A trimeric quaternary structure is conserved in bacterial and human glutamate transporters. J Biol Chem. 2004 Sep 17;279(38):39505-12. Epub 2004 Jul 20. 15265858
  10. Gebhardt FM, Mitrovic AD, Gilbert DF, Vandenberg RJ, Lynch JW, Dodd PR: Exon-skipping splice variants of excitatory amino acid transporter-2 (EAAT2) form heteromeric complexes with full-length EAAT2. J Biol Chem. 2010 Oct 8;285(41):31313-24. doi: 10.1074/jbc.M110.153494. Epub 2010 Aug 5. 20688910