You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameATP-binding cassette sub-family G member 1
Synonyms
  • ABC8
  • ATP-binding cassette transporter 8
  • White protein homolog
  • WHT1
Gene NameABCG1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0002323|ATP-binding cassette sub-family G member 1
MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNL
TEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPS
GAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMV
SAHLKLQEKDEGRREMVKEILTALGLLSCANTRTGSLSGGQRKRLAIALELVNNPPVMFF
DEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKLFELFDQLYVLSQGQCVYRGK
VCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCDSDHKRDLGGD
AEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDS
VLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLE
MGVFLREHLNYWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAAL
GTMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYIS
YVRYGFEGVILSIYGLDREDLHCDIDETCHFQKSEAILRELDVENAKLYLDFIVLGIFFI
SLRLIAYFVLRYKIRAER
Number of residues678
Molecular Weight75591.275
Theoretical pI7.87
GO Classification
Functions
  • glycoprotein transporter activity
  • protein homodimerization activity
  • sterol-transporting ATPase activity
  • toxin transporter activity
  • ATP binding
  • protein heterodimerization activity
  • phospholipid binding
  • protein dimerization activity
  • ADP binding
  • cholesterol binding
  • cholesterol transporter activity
  • phospholipid transporter activity
Processes
  • cholesterol homeostasis
  • small molecule metabolic process
  • cholesterol metabolic process
  • intracellular cholesterol transport
  • lipoprotein metabolic process
  • regulation of transcription, DNA-templated
  • amyloid precursor protein catabolic process
  • negative regulation of cholesterol storage
  • detection of hormone stimulus
  • negative regulation of macrophage derived foam cell differentiation
  • glycoprotein transport
  • phospholipid efflux
  • transmembrane transport
  • regulation of cholesterol esterification
  • phospholipid homeostasis
  • response to high density lipoprotein particle
  • positive regulation of cholesterol efflux
  • toxin transport
  • reverse cholesterol transport
  • low-density lipoprotein particle remodeling
  • high-density lipoprotein particle remodeling
  • response to organic substance
  • response to lipid
  • cholesterol efflux
  • positive regulation of cholesterol biosynthetic process
Components
  • nucleoplasm
  • external side of plasma membrane
  • integral component of plasma membrane
  • intracellular membrane-bounded organelle
  • mitochondrion
  • Golgi membrane
  • plasma membrane
  • recycling endosome
  • endosome
  • endoplasmic reticulum membrane
  • Golgi apparatus
  • integral component of membrane
General FunctionToxin transporter activity
Specific FunctionTransporter involved in macrophage lipid homeostasis. Is an active component of the macrophage lipid export complex. Could also be involved in intracellular lipid transport processes. The role in cellular lipid homeostasis may not be limited to macrophages.
Pfam Domain Function
Transmembrane Regions427-445 457-477 507-525 534-555 568-586 650-669
GenBank Protein ID1160186
UniProtKB IDP45844
UniProtKB Entry NameABCG1_HUMAN
Cellular LocationEndoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0010816|ATP-binding cassette sub-family G member 1 (ABCG1)
ATGGCCTGTCTGATGGCCGCTTTCTCGGTCGGCACCGCCATGAATGCCAGCAGTTACTCT
GCAGAGATGACGGAGCCCAAGTCGGTGTGTGTCTCGGTGGATGAGGTGGTGTCCAGCAAC
ATGGAGGCCACTGAGACGGACCTGCTGAATGGACATCTGAAAAAAGTAGATAATAACCTC
ACGGAAGCCCAGCGCTTCTCCTCCTTGCCTCGGAGGGCAGCTGTGAACATTGAATTCAGG
GACCTTTCCTATTCGGTTCCTGAAGGACCCTGGTGGAGGAAGAAAGGATACAAGACCCTC
CTGAAAGGAATTTCCGGGAAGTTCAATAGTGGTGAGTTGGTGGCCATTATGGGTCCTTCC
GGGGCCGGGAAGTCCACGCTGATGAACATCCTGGCTGGATACAGGGAGACGGGCATGAAG
GGGGCCGTCCTCATCAACGGCCTGCCCCGGGACCTGCGCTGCTTCCGGAAGGTGTCCTGC
TACATCATGCAGGATGACATGCTGCTGCCGCATCTCACTGTGCAGGAGGCCATGATGGTG
TCGGCACATCTGAAGCTTCAGGAGAAGGATGAAGGCAGAAGGGAAATGGTCAAGGAGATA
CTGACAGCGCTGGGCTTGCTGTCTTGCGCCAACACGCGGACCGGGAGCCTGTCAGGTGGT
CAGCGCAAGCGCCTGGCCATCGCGCTGGAGCTGGTGAACAACCCTCCAGTCATGTTCTTC
GATGAGCCCACCAGCGGCCTGGACAGCGCCTCCTGCTTCCAGGTGGTCTCGCTGATGAAA
GGGCTCGCTCAAGGGGGTCGCTCCATCATTTGCACCATCCACCAGCCCAGCGCCAAACTC
TTCGAGCTGTTCGACCAGCTTTACGTCCTGAGTCAAGGACAATGTGTGTACCGGGGAAAA
GTCTGCAATCTTGTGCCATATTTGAGGGATTTGGGTCTGAACTGCCCAACCTACCACAAC
CCAGCAGATTTTGTCATGGAGGTTGCATCCGGCGAGTACGGTGATCAGAACAGTCGGCTG
GTGAGAGCGGTTCGGGAGGGCATGTGTGACTCAGACCACAAGAGAGACCTCGGGGGTGAT
GCCGAGGTGAACCCTTTTCTTTGGCACCGGCCCTCTGAAGAGGTAAAGCAGACAAAACGA
TTAAAGGGGTTGAGAAAGGACTCCTCGTCCATGGAAGGCTGCCACAGCTTCTCTGCCAGC
TGCCTCACGCAGTTCTGCATCCTCTTCAAGAGGACCTTCCTCAGCATCATGAGGGACTCG
GTCCTGACACACCTGCGCATCACCTCGCACATTGGGATCGGCCTCCTCATTGGCCTGCTG
TACTTGGGGATCGGGAACGAAGCCAAGAAGGTCTTGAGCAACTCCGGCTTCCTCTTCTTC
TCCATGCTGTTCCTCATGTTCGCGGCCCTCATGCCTACTGTTCTGACATTTCCCCTGGAG
ATGGGAGTCTTTCTTCGGGAACACCTGAACTACTGGTACAGCCTGAAGGCCTACTACCTG
GCCAAGACCATGGCAGACGTGCCCTTTCAGATCATGTTCCCAGTGGCCTACTGCAGCATC
GTGTACTGGATGACGTCGCAGCCGTCCGACGCCGTGCGCTTTGTGCTGTTTGCCGCGCTG
GGCACCATGACCTCCCTGGTGGCACAGTCCCTGGGCCTGCTGATCGGAGCCGCCTCCACG
TCCCTGCAGGTGGCCACTTTCGTGGGCCCAGTGACAGCCATCCCGGTGCTCCTGTTCTCG
GGGTTCTTCGTCAGCTTCGACACCATCCCCACGTACCTACAGTGGATGTCCTACATCTCC
TATGTCAGGTATGGGTTCGAAGGGGTCATCCTCTCCATCTATGGCTTAGACCGGGAAGAT
CTGCACTGTGACATCGACGAGACGTGCCACTTCCAGAAGTCGGAGGCCATCCTGCGGGAG
CTGGACGTGGAAAATGCCAAGCTGTACCTGGACTTCATCGTACTCGGGATTTTCTTCATC
TCCCTCCGCCTCATTGCCTATTTTGTCCTCAGGTACAAAATCCGGGCAGAGAGGTAA
GenBank Gene IDX91249
GeneCard IDNot Available
GenAtlas IDABCG1
HGNC IDHGNC:73
Chromosome Location21
LocusNot Available
References
  1. Chen H, Rossier C, Lalioti MD, Lynn A, Chakravarti A, Perrin G, Antonarakis SE: Cloning of the cDNA for a human homologue of the Drosophila white gene and mapping to chromosome 21q22.3. Am J Hum Genet. 1996 Jul;59(1):66-75. 8659545
  2. Berry A, Scott HS, Kudoh J, Talior I, Korostishevsky M, Wattenhofer M, Guipponi M, Barras C, Rossier C, Shibuya K, Wang J, Kawasaki K, Asakawa S, Minoshima S, Shimizu N, Antonarakis S, Bonne-Tamir B: Refined localization of autosomal recessive nonsyndromic deafness DFNB10 locus using 34 novel microsatellite markers, genomic structure, and exclusion of six known genes in the region. Genomics. 2000 Aug 15;68(1):22-9. 10950923
  3. Porsch-Ozcurumez M, Langmann T, Heimerl S, Borsukova H, Kaminski WE, Drobnik W, Honer C, Schumacher C, Schmitz G: The zinc finger protein 202 (ZNF202) is a transcriptional repressor of ATP binding cassette transporter A1 (ABCA1) and ABCG1 gene expression and a modulator of cellular lipid efflux. J Biol Chem. 2001 Apr 13;276(15):12427-33. Epub 2001 Jan 22. 11279031
  4. Lorkowski S, Rust S, Engel T, Jung E, Tegelkamp K, Galinski EA, Assmann G, Cullen P: Genomic sequence and structure of the human ABCG1 (ABC8) gene. Biochem Biophys Res Commun. 2001 Jan 12;280(1):121-31. 11162488
  5. Kennedy MA, Venkateswaran A, Tarr PT, Xenarios I, Kudoh J, Shimizu N, Edwards PA: Characterization of the human ABCG1 gene: liver X receptor activates an internal promoter that produces a novel transcript encoding an alternative form of the protein. J Biol Chem. 2001 Oct 19;276(42):39438-47. Epub 2001 Aug 10. 11500512
  6. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. 10830953
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Croop JM, Tiller GE, Fletcher JA, Lux ML, Raab E, Goldenson D, Son D, Arciniegas S, Wu RL: Isolation and characterization of a mammalian homolog of the Drosophila white gene. Gene. 1997 Jan 31;185(1):77-85. 9034316
  9. Venkateswaran A, Repa JJ, Lobaccaro JM, Bronson A, Mangelsdorf DJ, Edwards PA: Human white/murine ABC8 mRNA levels are highly induced in lipid-loaded macrophages. A transcriptional role for specific oxysterols. J Biol Chem. 2000 May 12;275(19):14700-7. 10799558
  10. Klucken J, Buchler C, Orso E, Kaminski WE, Porsch-Ozcurumez M, Liebisch G, Kapinsky M, Diederich W, Drobnik W, Dean M, Allikmets R, Schmitz G: ABCG1 (ABC8), the human homolog of the Drosophila white gene, is a regulator of macrophage cholesterol and phospholipid transport. Proc Natl Acad Sci U S A. 2000 Jan 18;97(2):817-22. 10639163
  11. Kaplan R, Gan X, Menke JG, Wright SD, Cai TQ: Bacterial lipopolysaccharide induces expression of ABCA1 but not ABCG1 via an LXR-independent pathway. J Lipid Res. 2002 Jun;43(6):952-9. 12032171
  12. Schmitz G, Langmann T, Heimerl S: Role of ABCG1 and other ABCG family members in lipid metabolism. J Lipid Res. 2001 Oct;42(10):1513-20. 11590207
  13. Lorkowski S, Kratz M, Wenner C, Schmidt R, Weitkamp B, Fobker M, Reinhardt J, Rauterberg J, Galinski EA, Cullen P: Expression of the ATP-binding cassette transporter gene ABCG1 (ABC8) in Tangier disease. Biochem Biophys Res Commun. 2001 May 18;283(4):821-30. 11350058
  14. Uhlen M, Oksvold P, Algenas C, Hamsten C, Fagerberg L, Klevebring D, Lundberg E, Odeberg J, Ponten F, Kondo T, Sivertsson A: Antibody-based protein profiling of the human chromosome 21. Mol Cell Proteomics. 2012 Mar;11(3):M111.013458. doi: 10.1074/mcp.M111.013458. Epub 2011 Oct 31. 22042635
  15. Gu HM, Li G, Gao X, Berthiaume LG, Zhang DW: Characterization of palmitoylation of ATP binding cassette transporter G1: effect on protein trafficking and function. Biochim Biophys Acta. 2013 Jun;1831(6):1067-78. doi: 10.1016/j.bbalip.2013.01.019. Epub 2013 Feb 4. 23388354