You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSolute carrier family 15 member 1
Synonyms
  • Intestinal H(+)/peptide cotransporter
  • Oligopeptide transporter, small intestine isoform
  • PEPT1
  • Peptide transporter 1
Gene NameSLC15A1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010713|Solute carrier family 15 member 1
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
Number of residues708
Molecular Weight78805.265
Theoretical pI8.64
GO Classification
Functions
  • peptide
  • proton-dependent oligopeptide secondary active transmembrane transporter activity
Processes
  • transmembrane transport
  • transport
  • proton transport
  • ion transport
  • protein transport
  • digestion
Components
  • brush border
  • membrane
  • plasma membrane
  • integral component of plasma membrane
General FunctionProton-dependent oligopeptide secondary active transmembrane transporter activity
Specific FunctionProton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products.
Pfam Domain Function
Transmembrane Regions1-21 54-74 83-103 119-139 162-182 199-219 277-297 328-348 362-382 585-605 620-640 646-666
GenBank Protein ID773588
UniProtKB IDP46059
UniProtKB Entry NameS15A1_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0010714|Solute carrier family 15 member 1 (SLC15A1)
ATGGGAATGTCCAAATCACACAGTTTCTTTGGTTATCCCCTGAGCATCTTCTTCATCGTG
GTCAATGAGTTTTGCGAAAGATTTTCCTACTATGGAATGCGAGCAATCCTGATTCTGTAC
TTCACAAATTTCATCAGCTGGGATGATAACCTGTCCACCGCCATCTACCATACGTTTGTG
GCTCTGTGCTACCTGACGCCAATTCTCGGAGCTCTTATCGCCGACTCGTGGCTGGGAAAG
TTCAAGACCATTGTGTCGCTCTCCATTGTCTACACAATTGGACAAGCAGTCACCTCAGTA
AGCTCCATTAATGACCTCACAGACCACAACCATGATGGCACCCCCGACAGCCTTCCTGTG
CACGTGGTGCTGTCCTTGATCGGCCTGGCCCTGATAGCTCTCGGGACTGGAGGAATCAAA
CCCTGTGTGTCTGCGTTTGGTGGAGATCAGTTTGAAGAGGGCCAGGAGAAACAAAGAAAC
AGATTTTTTTCCATCTTTTACTTGGCTATTAATGCTGGAAGTTTGCTTTCCACAATCATC
ACACCCATGCTCAGAGTTCAACAATGTGGAATTCACAGTAAACAAGCTTGTTACCCACTG
GCCTTTGGGGTTCCTGCTGCTCTCATGGCTGTAGCCCTGATTGTGTTTGTCCTTGGCAGT
GGGATGTACAAGAAGTTCAAGCCACAGGGCAACATCATGGGTAAAGTGGCCAAGTGCATC
GGTTTTGCCATCAAAAATAGATTTAGGCATCGGAGTAAGGCATTTCCCAAGAGGGAGCAC
TGGCTGGACTGGGCTAAAGAGAAATACGATGAGCGGCTCATCTCCCAAATTAAGATGGTT
ACGAGGGTGATGTTCCTGTATATTCCACTCCCAATGTTCTGGGCCTTGTTTGACCAGCAG
GGCTCCAGGTGGACACTGCAGGCAACAACTATGTCCGGGAAAATCGGAGCTCTTGAAATT
CAGCCCGATCAGATGCAGACCGTGAACGCCATCCTGATCGTGATCATGGTCCCGATCTTC
GATGCTGTGCTGTACCCTCTCATTGCAAAATGTGGCTTCAATTTCACCTCCTTGAAGAAG
ATGGCAGTTGGCATGGTCCTGGCCTCCATGGCCTTTGTGGTGGCTGCCATCGTGCAGGTG
GAAATCGATAAAACTCTTCCAGTCTTCCCCAAAGGAAACGAAGTCCAAATTAAAGTTTTG
AATATAGGAAACAATACCATGAATATATCTCTTCCTGGAGAGATGGTGACACTTGGCCCA
ATGTCTCAAACAAATGCATTTATGACTTTTGATGTAAACAAACTGACAAGGATAAACATT
TCTTCTCCTGGATCACCAGTCACTGCTGTAACTGACGACTTCAAGCAGGGCCAACGCCAC
ACGCTTCTAGTGTGGGCCCCCAATCACTACCAGGTGGTAAAGGATGGTCTTAACCAGAAG
CCAGAAAAAGGGGAAAATGGAATCAGATTTGTAAATACTTTTAACGAGCTCATCACCATC
ACAATGAGTGGGAAAGTTTATGCAAACATCAGCAGCTACAATGCCAGCACATACCAGTTT
TTTCCTTCTGGCATAAAAGGCTTCACAATAAGCTCAACAGAGATTCCGCCACAATGTCAA
CCTAATTTCAATACTTTCTACCTTGAATTTGGTAGTGCTTATACCTATATAGTCCAAAGG
AAGAATGACAGCTGCCCTGAAGTGAAGGTGTTTGAAGATATTTCAGCCAACACAGTTAAC
ATGGCTCTGCAAATCCCGCAGTATTTTCTTCTCACCTGTGGCGAAGTGGTCTTCTCTGTC
ACGGGATTGGAATTCTCATATTCTCAGGCTCCTTCCAACATGAAGTCGGTGCTTCAGGCA
GGATGGCTGCTGACCGTGGCTGTTGGCAACATCATTGTGCTCATCGTGGCAGGGGCAGGC
CAGTTCAGCAAACAGTGGGCCGAGTACATTCTATTTGCCGCGTTGCTTCTGGTCGTCTGT
GTAATTTTTGCCATCATGGCTCGGTTCTATACTTACATCAACCCAGCGGAGATCGAAGCT
CAATTTGATGAGGATGAAAAGAAAAACAGACTGGAAAAGAGTAACCCATATTTCATGTCA
GGGGCCAATTCACAGAAACAGATGTGA
GenBank Gene IDU13173
GeneCard IDNot Available
GenAtlas IDSLC15A1
HGNC IDHGNC:10920
Chromosome Location13
Locus13q33-q34
References
  1. Liang R, Fei YJ, Prasad PD, Ramamoorthy S, Han H, Yang-Feng TL, Hediger MA, Ganapathy V, Leibach FH: Human intestinal H+/peptide cotransporter. Cloning, functional expression, and chromosomal localization. J Biol Chem. 1995 Mar 24;270(12):6456-63. 7896779
  2. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. 15057823
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Saito S, Iida A, Sekine A, Ogawa C, Kawauchi S, Higuchi S, Nakamura Y: Catalog of 238 variations among six human genes encoding solute carriers ( hSLCs) in the Japanese population. J Hum Genet. 2002;47(11):576-84. 12436193
  5. Anderle P, Nielsen CU, Pinsonneault J, Krog PL, Brodin B, Sadee W: Genetic variants of the human dipeptide transporter PEPT1. J Pharmacol Exp Ther. 2006 Feb;316(2):636-46. Epub 2005 Oct 28. 16258023