You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameB1 bradykinin receptor
Synonyms
  • B1R
  • BRADYB1
Gene NameBDKRB1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013954|B1 bradykinin receptor
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Number of residues353
Molecular Weight40494.29
Theoretical pINot Available
GO Classification
Functions
  • peptide binding
  • bradykinin receptor activity
Processes
  • positive regulation of leukocyte migration
  • negative regulation of protein phosphorylation
  • inflammatory response
  • cell migration
  • positive regulation of cytosolic calcium ion concentration
  • positive regulation of release of sequestered calcium ion into cytosol
  • protein kinase C-activating G-protein coupled receptor signaling pathway
  • response to lipopolysaccharide
  • sensory perception of pain
  • negative regulation of blood pressure
  • response to mechanical stimulus
  • negative regulation of cell growth
Components
  • endoplasmic reticulum
  • plasma membrane
  • cytosol
  • integral component of plasma membrane
  • neuron projection
General FunctionPeptide binding
Specific FunctionThis is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Pfam Domain Function
Transmembrane Regions41-64 74-98 112-133 156-178 200-226 248-272 292-314
GenBank Protein IDNot Available
UniProtKB IDP46663
UniProtKB Entry NameBKRB1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013955|B1 bradykinin receptor (BDKRB1)
ATGGCATCATCCTGGCCCCCTCTAGAGCTCCAATCCTCCAACCAGAGCCAGCTCTTCCCT
CAAAATGCTACGGCCTGTGACAATGCTCCAGAAGCCTGGGACCTGCTGCACAGAGTGCTG
CCAACATTTATCATCTCCATCTGTTTCTTCGGCCTCCTAGGGAACCTTTTTGTCCTGTTG
GTCTTCCTCCTGCCCCGGCGGCAACTGAACGTGGCAGAAATCTACCTGGCCAACCTGGCA
GCCTCTGATCTGGTGTTTGTCTTGGGCTTGCCCTTCTGGGCAGAGAATATCTGGAACCAG
TTTAACTGGCCTTTCGGAGCCCTCCTCTGCCGTGTCATCAACGGGGTCATCAAGGCCAAT
TTGTTCATCAGCATCTTCCTGGTGGTGGCCATCAGCCAGGACCGCTACCGCGTGCTGGTG
CACCCTATGGCCAGCCGGAGGCAGCAGCGGCGGAGGCAGGCCCGGGTCACCTGCGTGCTC
ATCTGGGTTGTGGGGGGCCTCTTGAGCATCCCCACATTCCTGCTGCGATCCATCCAAGCC
GTCCCAGATCTGAACATCACCGCCTGCATCCTGCTCCTCCCCCATGAGGCCTGGCACTTT
GCAAGGATTGTGGAGTTAAATATTCTGGGTTTCCTCCTACCACTGGCTGCGATCGTCTTC
TTCAACTACCACATCCTGGCCTCCCTGCGAACGCGGGAGGAGGTCAGCAGGACAAGGTGC
GGGGGCCGCAAGGATAGCAAGACCACAGCGCTGATCCTCACGCTCGTGGTTGCCTTCCTG
GTCTGCTGGGCCCCTTACCACTTCTTTGCCTTCCTGGAATTCTTATTCCAGGTGCAAGCA
GTCCGAGGCTGCTTTTGGGAGGACTTCATTGACCTGGGCCTGCAATTGGCCAACTTCTTT
GCCTTCACTAACAGCTCCCTGAATCCAGTAATTTATGTCTTTGTGGGCCGGCTCTTCAGG
ACCAAGGTCTGGGAACTTTATAAACAATGCACCCCTAAAAGTCTTGCTCCAATATCTTCA
TCCCATAGGAAAGAAATCTTCCAACTTTTCTGGCGGAATTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1029
Chromosome Location14
LocusNot Available
References
  1. Menke JG, Borkowski JA, Bierilo KK, MacNeil T, Derrick AW, Schneck KA, Ransom RW, Strader CD, Linemeyer DL, Hess JF: Expression cloning of a human B1 bradykinin receptor. J Biol Chem. 1994 Aug 26;269(34):21583-6. 8063797
  2. Yang X, Polgar P: Genomic structure of the human bradykinin B1 receptor gene and preliminary characterization of its regulatory regions. Biochem Biophys Res Commun. 1996 May 24;222(3):718-25. 8651911
  3. Bachvarov DR, Hess JF, Menke JG, Larrivee JF, Marceau F: Structure and genomic organization of the human B1 receptor gene for kinins (BDKRB1). Genomics. 1996 May 1;33(3):374-81. 8660997
  4. Jones C, Phillips E, Davis C, Arbuckle J, Yaqoob M, Burgess GM, Docherty RJ, Webb M, Bevan SJ, McIntyre P: Molecular characterisation of cloned bradykinin B1 receptors from rat and human. Eur J Pharmacol. 1999 Jun 25;374(3):423-33. 10422787
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334