You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameP2Y purinoceptor 1
Synonyms
  • ATP receptor
  • P2Y1
  • Purinergic receptor
Gene NameP2RY1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013693|P2Y purinoceptor 1
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
Number of residues373
Molecular Weight42071.08
Theoretical pINot Available
GO Classification
Functions
  • receptor activity
  • ADP binding
  • ATP binding
  • ADP-activated adenosine receptor activity
  • ATP-activated adenosine receptor activity
  • G-protein coupled purinergic nucleotide receptor activity
  • scaffold protein binding
Processes
  • regulation of receptor activity
  • G-protein coupled receptor signaling pathway
  • aging
  • cell surface receptor signaling pathway
  • protein localization to plasma membrane
  • positive regulation of inositol trisphosphate biosynthetic process
  • phospholipase C-activating G-protein coupled receptor signaling pathway
  • blood coagulation
  • positive regulation of penile erection
  • regulation of vasodilation
  • eating behavior
  • positive regulation of ion transport
  • sensory perception of pain
  • cellular response to organic cyclic compound
  • response to growth factor
  • adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
  • platelet activation
  • signal transduction involved in regulation of gene expression
  • glial cell migration
  • negative regulation of norepinephrine secretion
  • positive regulation of cytosolic calcium ion concentration
  • positive regulation of protein phosphorylation
  • negative regulation of binding
  • positive regulation of transcription from RNA polymerase II promoter
  • positive regulation of hormone secretion
  • positive regulation of ERK1 and ERK2 cascade
  • relaxation of muscle
  • response to mechanical stimulus
Components
  • mitochondrion
  • postsynaptic membrane
  • plasma membrane
  • apical plasma membrane
  • cell surface
  • cytosol
  • cell body
  • neuronal postsynaptic density
  • integral component of plasma membrane
  • basolateral plasma membrane
  • dendrite
General FunctionScaffold protein binding
Specific FunctionReceptor for extracellular adenine nucleotides such as ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation.
Pfam Domain Function
Transmembrane Regions53-74 88-109 127-147 167-188 219-238 266-285 304-328
GenBank Protein IDNot Available
UniProtKB IDP47900
UniProtKB Entry NameP2RY1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013694|P2Y purinoceptor 1 (P2RY1)
ATGACCGAGGTGCTGTGGCCGGCTGTCCCCAACGGGACGGACGCTGCCTTCCTGGCCGGT
CCGGGTTCGTCCTGGGGGAACAGCACGGTCGCCTCCACTGCCGCCGTCTCCTCGTCGTTC
AAATGCGCCTTGACCAAGACGGGCTTCCAGTTTTACTACCTGCCGGCTGTCTACATCTTG
GTATTCATCATCGGCTTCCTGGGCAACAGCGTGGCCATCTGGATGTTCGTCTTCCACATG
AAGCCCTGGAGCGGCATCTCCGTGTACATGTTCAATTTGGCTCTGGCCGACTTCTTGTAC
GTGCTGACTCTGCCAGCCCTGATCTTCTACTACTTCAATAAAACAGACTGGATCTTCGGG
GATGCCATGTGTAAACTGCAGAGGTTCATCTTTCATGTGAACCTCTATGGCAGCATCTTG
TTTCTGACATGCATCAGTGCCCACCGGTACAGCGGTGTGGTGTACCCCCTCAAGTCCCTG
GGCCGGCTCAAAAAGAAGAATGCGATCTGTATCAGCGTGCTGGTGTGGCTCATTGTGGTG
GTGGCGATCTCCCCCATCCTCTTCTACTCAGGTACCGGGGTCCGCAAAAACAAAACCATC
ACCTGTTACGACACCACCTCAGACGAGTACCTGCGAAGTTATTTCATCTACAGCATGTGC
ACGACCGTGGCCATGTTCTGTGTCCCCTTGGTGCTGATTCTGGGCTGTTACGGATTAATT
GTGAGAGCTTTGATTTACAAAGATCTGGACAACTCTCCTCTGAGGAGAAAATCGATTTAC
CTGGTAATCATTGTACTGACTGTTTTTGCTGTGTCTTACATCCCTTTCCATGTGATGAAA
ACGATGAACTTGAGGGCCCGGCTTGATTTTCAGACCCCAGCAATGTGTGCTTTCAATGAC
AGGGTTTATGCCACGTATCAGGTGACAAGAGGTCTAGCAAGTCTCAACAGTTGTGTGGAC
CCCATTCTCTATTTCTTGGCGGGAGATACTTTCAGAAGGAGACTCTCCCGAGCCACAAGG
AAAGCTTCTAGAAGAAGTGAGGCAAATTTGCAATCCAAGAGTGAAGACATGACCCTCAAT
ATTTTACCTGAGTTCAAGCAGAATGGAGATACAAGCCTGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:8539
Chromosome Location3
LocusNot Available
References
  1. Leon C, Vial C, Cazenave JP, Gachet C: Cloning and sequencing of a human cDNA encoding endothelial P2Y1 purinoceptor. Gene. 1996 Jun 1;171(2):295-7. 8666290
  2. Ayyanathan K, Webbs TE, Sandhu AK, Athwal RS, Barnard EA, Kunapuli SP: Cloning and chromosomal localization of the human P2Y1 purinoceptor. Biochem Biophys Res Commun. 1996 Jan 26;218(3):783-8. 8579591
  3. Janssens R, Communi D, Pirotton S, Samson M, Parmentier M, Boeynaems JM: Cloning and tissue distribution of the human P2Y1 receptor. Biochem Biophys Res Commun. 1996 Apr 25;221(3):588-93. 8630005
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Jin J, Daniel JL, Kunapuli SP: Molecular basis for ADP-induced platelet activation. II. The P2Y1 receptor mediates ADP-induced intracellular calcium mobilization and shape change in platelets. J Biol Chem. 1998 Jan 23;273(4):2030-4. 9442040
  6. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. 18088087