You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGalectin-7
Synonyms
  • Gal-7
  • HKL-14
  • p53-induced gene 1 protein
  • PI7
  • PIG1
Gene NameLGALS7
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010705|Galectin-7
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
Number of residues136
Molecular Weight15074.965
Theoretical pI7.79
GO Classification
Functions
  • carbohydrate binding
Processes
  • apoptotic process
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
Components
  • cytoplasm
  • nucleus
  • extracellular space
  • extracellular exosome
General FunctionCarbohydrate binding
Specific FunctionCould be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID182132
UniProtKB IDP47929
UniProtKB Entry NameLEG7_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0010706|Galectin-7 (LGALS7)
ATGTCCAACGTCCCCCACAAGTCCTCACTGCCCGAGGGCATCCGCCCTGGCACGGTGCTG
AGAATTCGCGGCTTGGTTCCTCCCAATGCCAGCAGGTTCCATGTAAACCTGCTGTGCGGG
GAGGAGCAGGGCTCCGATGCCGCGCTGCATTTCAACCCCCGGCTGGACACGTCGGAGGTG
GTCTTCAACAGCAAGGAGCAAGGCTCCTGGGGCCGCGAGGAGCGCGGGCCGGGCGTTCCT
TTCCAGCGCGGGCAGCCCTTCGAGGTGCTCATCATCGCGTCAGACGACGGCTTCAAGGCC
GTGGTTGGGGACGCCCAGTACCACCACTTCCGCCACCGCCTGCCGCTGGCGCGCGTGCGC
CTGGTGGAGGTGGGCGGGGACGTGCAGCTGGACTCCGTGAGGATCTTCTGA
GenBank Gene IDL07769
GeneCard IDNot Available
GenAtlas IDLGALS7
HGNC IDHGNC:6568
Chromosome Location19
Locus19q13.2
References
  1. Madsen P, Rasmussen HH, Flint T, Gromov P, Kruse TA, Honore B, Vorum H, Celis JE: Cloning, expression, and chromosome mapping of human galectin-7. J Biol Chem. 1995 Mar 17;270(11):5823-9. 7534301
  2. Magnaldo T, Bernerd F, Darmon M: Galectin-7, a human 14-kDa S-lectin, specifically expressed in keratinocytes and sensitive to retinoic acid. Dev Biol. 1995 Apr;168(2):259-71. 7729568
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Kuwabara I, Kuwabara Y, Yang RY, Schuler M, Green DR, Zuraw BL, Hsu DK, Liu FT: Galectin-7 (PIG1) exhibits pro-apoptotic function through JNK activation and mitochondrial cytochrome c release. J Biol Chem. 2002 Feb 1;277(5):3487-97. Epub 2001 Nov 8. 11706006
  5. Leonidas DD, Vatzaki EH, Vorum H, Celis JE, Madsen P, Acharya KR: Structural basis for the recognition of carbohydrates by human galectin-7. Biochemistry. 1998 Oct 6;37(40):13930-40. 9760227