You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamate receptor 4
Synonyms
  • AMPA-selective glutamate receptor 4
  • GluA4
  • GluR-4
  • GluR-D
  • GLUR4
  • Glutamate receptor ionotropic, AMPA 4
Gene NameGRIA4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037088|Glutamate receptor 4
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
Number of residues902
Molecular Weight100870.085
Theoretical pI8.32
GO Classification
Functions
  • ionotropic glutamate receptor activity
  • extracellular-glutamate-gated ion channel activity
  • AMPA glutamate receptor activity
Processes
  • transport
  • synaptic transmission
  • ion transmembrane transport
  • glutamate receptor signaling pathway
  • synaptic transmission, glutamatergic
  • ionotropic glutamate receptor signaling pathway
Components
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • extracellular vesicle
  • dendrite
  • endocytic vesicle membrane
  • AMPA glutamate receptor complex
General FunctionIonotropic glutamate receptor activity
Specific FunctionReceptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.
Pfam Domain Function
Transmembrane Regions545-565 618-638 814-834
GenBank Protein ID790538
UniProtKB IDP48058
UniProtKB Entry NameGRIA4_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0016220|Glutamate receptor 4 (GRIA4)
ATGAGGATTATTTCCAGACAGATTGTCTTGTTATTTTCTGGATTTTGGGGACTCGCCATG
GGAGCCTTTCCGAGCAGCGTGCAAATAGGTGGTCTCTTCATCCGAAACACAGATCAGGAA
TACACTGCTTTTCGATTAGCAATTTTTCTTCATAACACCAGCCCCAATGCGTCGGAAGCT
CCTTTTAATTTGGTACCTCATGTGGACAACATTGAGACAGCCAACAGTTTTGCTGTAACA
AACGCCTTCTGTTCCCAGTATTCTAGAGGAGTATTTGCCATTTTTGGACTCTATGATAAG
AGGTCGGTACATACCTTGACCTCATTCTGCAGCGCCTTACATATCTCCCTCATCACACCA
AGTTTCCCTACTGAGGGGGAGAGCCAGTTTGTGCTGCAACTAAGACCTTCGTTACGAGGA
GCACTCTTGAGTTTGCTGGATCACTACGAATGGAACTGTTTTGTCTTCCTGTATGACACA
GACAGGGGATACTCGATACTCCAAGCTATTATGGAAAAAGCAGGACAAAATGGTTGGCAT
GTCAGCGCTATATGTGTGGAAAATTTTAATGATGTCAGCTATAGGCAACTTCTAGAAGAA
CTTGACAGAAGACAAGAGAAGAAGTTTGTAATAGACTGTGAGATAGAGAGACTTCAAAAC
ATATTAGAACAGATTGTAAGTGTTGGAAAGCATGTTAAAGGCTACCATTATATCATTGCA
AACTTGGGATTCAAGGATATTTCTCTTGAGAGGTTTATACATGGTGGAGCCAATGTTACT
GGATTCCAGTTGGTGGATTTTAATACACCTATGGTAATCAAACTAATGGATCGCTGGAAG
AAACTAGATCAGAGAGAGTATCCAGGATCTGAGACTCCTCCAAAGTACACCTCTGCTCTG
ACTTATGATGGAGTCCTTGTGATGGCTGAAACTTTCCGAAGTCTTAGGAGGCAGAAAATT
GATATCTCAAGGAGAGGAAATGCTGGGGATTGTCTGGCAAATCCTGCTGCTCCATGGGGC
CAGGGAATTGACATGGAGAGGACACTCAAACAGGTTCGAATTCAAGGGCTGACAGGGAAT
GTTCAGTTTGACCACTATGGACGTAGAGTCAATTACACAATGGATGTGTTTGAGCTGAAA
AGCACAGGACCTAGAAAGGTTGGTTACTGGAATGATATGGATAAGTTAGTCTTGATTCAA
GATGTACCAACTCTTGGCAATGACACAGCTGCTATTGAGAACAGAACAGTGGTTGTAACC
ACAATTATGGAATCCCCATATGTTATGTACAAGAAAAATCATGAAATGTTTGAAGGAAAT
GACAAGTATGAAGGATACTGTGTAGATTTGGCATCTGAAATTGCAAAACATATTGGTATC
AAGTATAAAATTGCCATTGTCCCTGATGGAAAATATGGAGCAAGGGATGCAGACACAAAA
ATCTGGAATGGGATGGTAGGAGAACTTGTTTATGGGAAAGCAGAGATTGCTATTGCCCCT
CTGACAATCACTTTGGTACGAGAGGAGGTCATTGACTTTTCTAAGCCCTTCATGAGTTTG
GGCATATCTATCATGATCAAAAAGCCTCAGAAATCCAAACCAGGAGTGTTTTCCTTCTTG
GATCCTCTGGCCTATGAGATTTGGATGTGCATAGTCTTTGCCTACATTGGTGTCAGCGTG
GTCTTATTCCTAGTTAGTAGATTTAGTCCATATGAGTGGCACACAGAAGAGCCAGAGGAC
GGAAAGGAAGGACCCAGCGACCAGCCTCCCAATGAGTTTGGCATCTTTAACAGCCTCTGG
TTTTCCCTGGGTGCTTTTATGCAGCAAGGATGTGACATTTCACCCAGATCCCTCTCAGGT
CGAATTGTTGGAGGTGTTTGGTGGTTCTTTACACTCATCATTATATCATCTTATACTGCT
AACCTCGCTGCTTTCCTGACGGTTGAGCGAATGGTCTCTCCCATAGAAAGTGCAGAAGAC
CTGGCCAAACAAACAGAAATTGCCTATGGAACACTGGATTCAGGATCAACAAAAGAATTC
TTCAGAAGATCAAAAATAGCAGTGTATGAAAAGATGTGGACCTACATGCGATCAGCAGAG
CCATCAGTATTCACTAGGACTACAGCTGAGGGAGTAGCTCGTGTCCGCAAATCCAAGGGC
AAATTTGCCTTTCTCCTGGAGTCCACTATGAATGAATACATTGAGCAGCGAAAGCCATGT
GACACGATGAAAGTGGGAGGAAATCTGGATTCCAAAGGCTATGGAGTAGCAACGCCCAAG
GGTTCCTCATTAGGAACTCCTGTAAACCTTGCCGTTTTGAAACTCAGTGAGGCAGGCGTC
TTAGACAAGCTGAAAAACAAATGGTGGTACGATAAAGGTGAATGTGGACCCAAGGACTCT
GGAAGCAAGGACAAGACGAGTGCCTTGAGCCTGAGCAATGTAGCAGGCGTCTTCTACATT
CTGGTTGGCGGCTTGGGCTTGGCAATGCTGGTGGCTTTGATAGAGTTCTGTTACAAGTCC
AGGGCAGAAGCGAAGAGAATGAAGCTGACCTTTTCTGAAGCCATAAGAAACAAAGCCAGA
TTATCCATCACTGGGAGTGTGGGAGAGAATGGCCGCGTCTTGACGCCTGACTGCCCAAAG
GCTGTACACACTGGAACTGCAATCAGACAAAGTTCAGGATTGGCTGTCATTGCATCGGAC
CTACCATAA
GenBank Gene IDU16129
GeneCard IDNot Available
GenAtlas IDGRIA4
HGNC IDHGNC:4574
Chromosome Location11
Locus11q22
References
  1. Fletcher EJ, Nutt SL, Hoo KH, Elliott CE, Korczak B, McWhinnie EA, Kamboj RK: Cloning, expression and pharmacological characterization of a human glutamate receptor: hGluR4. Receptors Channels. 1995;3(1):21-31. 8589990
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Kato AS, Gill MB, Ho MT, Yu H, Tu Y, Siuda ER, Wang H, Qian YW, Nisenbaum ES, Tomita S, Bredt DS: Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins. Neuron. 2010 Dec 22;68(6):1082-96. doi: 10.1016/j.neuron.2010.11.026. 21172611