Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameIron-responsive element-binding protein 2
Synonyms
  • IRE-BP 2
  • Iron regulatory protein 2
  • IRP2
Gene NameIREB2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008975|Iron-responsive element-binding protein 2
MDAPKAGYAFEYLIETLNDSSHKKFFDVSKLGTKYDVLPYSIRVLLEAAVRNCDGFLMKK
EDVMNILDWKTKQSNVEVPFFPARVLLQDFTGIPAMVDFAAMREAVKTLGGDPEKVHPAC
PTDLTVDHSLQIDFSKCAIQNAPNPGGGDLQKAGKLSPVKVQPKKLPCRGQTTCRGSCDS
GELGRNSGTFSSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSRVFK
NVAVIPPGTGMAHQINLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGILGWGVGGIE
TEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAGKFVEFFGSGV
SQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRN
DQNSSGEPEYSQVIQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIA
AEKQKDIVSIHYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLRVKP
YIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIVGYGCSICVGNTAPLSDAVLNAVKQGD
LVTCGILSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTDPTGKNIY
LHDIWPSREEVHRVEEEHVILSMFKALKDKIEMGNKRWNSLEAPDSVLFPWDLKSTYIRC
PSFFDKLTKEPIALQAIENAHVLLYLGDSVTTDHISPAGSIARNSAAAKYLTNRGLTPRE
FNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIP
LIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENAD
SLGLSGRETFSLTFPEELSPGITLNIQTSTGKVFSVIASFEDDVEITLYKHGGLLNFVAR
KFS
Number of residues963
Molecular Weight105043.65
Theoretical pINot Available
GO Classification
Functions
  • iron-responsive element binding
  • translation repressor activity
  • RNA binding
  • metal ion binding
  • 4 iron, 4 sulfur cluster binding
Processes
  • metabolic process
  • iron ion transport
  • cellular iron ion homeostasis
Components
  • cytoplasm
General FunctionTranslation repressor activity
Specific FunctionRNA-binding protein that binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. Binding to the IRE element in ferritin results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP48200
UniProtKB Entry NameIREB2_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013541|Iron-responsive element-binding protein 2 (IREB2)
ATGGACGCCCCAAAAGCAGGATACGCCTTTGAGTACCTTATTGAAACATTAAATGACAGT
TCACATAAGAAGTTCTTCGATGTATCTAAACTTGGCACCAAGTATGATGTTCTGCCTTAC
TCAATACGGGTCTTGTTGGAAGCTGCTGTACGAAATTGTGATGGCTTTTTAATGAAGAAG
GAAGATGTTATGAACATTTTAGACTGGAAAACCAAACAAAGCAATGTTGAAGTGCCCTTT
TTCCCTGCCCGTGTTCTTCTTCAAGATTTTACTGGAATACCAGCAATGGTGGATTTTGCT
GCTATGAGGGAGGCAGTGAAAACTCTTGGAGGTGATCCTGAGAAAGTCCATCCTGCTTGT
CCGACAGATCTTACAGTTGACCATTCTTTACAAATTGACTTCAGTAAATGTGCAATACAG
AATGCACCAAATCCTGGAGGTGGTGACCTGCAGAAAGCAGGAAAGCTCTCTCCACTTAAA
GTGCAGCCTAAGAAGCTTCCCTGCAGAGGCCAGACTACCTGCCGAGGATCTTGTGATTCT
GGAGAACTAGGCCGAAACTCAGGAACATTTTCTTCGCAGATTGAGAATACACCCATCCTG
TGTCCTTTTCATTTGCAACCAGTGCCTGAACCTGAAACAGTGTTAAAAAATCAAGAAGTA
GAATTCGGCAGAAATCGAGAGAGGCTTCAGTTTTTTAAGTGGAGTTCAAGAGTTTTTAAG
AATGTGGCAGTGATCCCTCCTGGAACTGGAATGGCTCATCAAATAAACTTAGAATATTTG
TCAAGAGTGGTTTTTGAAGAAAAAGACCTCCTCTTCCCAGACAGTGTAGTCGGCACAGAT
TCACACATAACGATGGTGAATGGTTTAGGGATTCTGGGGTGGGGGGTTGGAGGCATTGAA
ACAGAAGCAGTTATGCTTGGTCTGCCAGTTTCTCTTACTTTACCAGAGGTGGTTGGATGT
GAGTTAACTGGGTCATCAAACCCTTTTGTTACATCCATAGATGTTGTTCTTGGTATTACA
AAGCACCTCAGGCAAGTAGGAGTGGCTGGAAAGTTTGTTGAGTTTTTTGGAAGTGGAGTT
TCACAATTATCTATAGTTGATCGAACTACAATAGCAAACATGTGTCCGGAATATGGTGCT
ATCCTCAGCTTTTTCCCTGTTGACAATGTGACATTAAAACATTTAGAACATACAGGTTTT
AGCAAAGCCAAACTCGAATCAATGGAAACATACCTTAAAGCTGTGAAATTGTTTCGAAAT
GACCAGAATTCTTCAGGAGAACCTGAATACTCCCAGGTGATCCAGATTAATCTGAATTCA
ATAGTTCCATCTGTTAGTGGTCCAAAAAGACCTCAGGATAGAGTTGCTGTGACAGATATG
AAAAGCGATTTCCAGGCTTGCTTAAATGAAAAGGTTGGATTTAAAGGCTTCCAAATTGCA
GCTGAAAAACAAAAGGATATTGTCTCCATTCATTATGAAGGAAGTGAATATAAGCTGTCT
CATGGATCAGTGGTCATTGCTGCAGTTATCAGTTGTACCAATAATTGCAATCCATCTGTC
ATGCTTGCTGCAGGTCTTTTGGCTAAAAAGGCTGTTGAAGCTGGTCTGCGTGTTAAACCT
TATATAAGAACAAGTTTATCTCCAGGCAGTGGGATGGTTACACATTACCTCAGTTCAAGT
GGAGTATTACCATATCTAAGTAAGCTTGGATTTGAAATCGTTGGCTATGGATGTTCAACT
TGTGTGGGAAATACAGCACCCTTATCAGACGCAGTTTTAAATGCAGTAAAACAGGGTGAT
TTGGTTACCTGTGGAATTTTATCTGGAAACAAAAATTTTGAAGGTCGTCTTTGTGATTGT
GTTCGTGCCAATTATCTTGCCTCTCCACCCTTAGTGGTAGCTTATGCCATAGCAGGCACA
GTGAATATAGATTTCCAGACAGAACCTTTAGGTACTGACCCCACCGGCAAGAACATTTAC
CTGCATGATATTTGGCCTAGTCGAGAAGAAGTTCATCGAGTAGAGGAAGAACATGTTATA
CTATCCATGTTTAAAGCATTAAAAGATAAAATAGAAATGGGGAATAAACGGTGGAATTCC
TTAGAAGCACCGGATTCAGTTTTGTTTCCATGGGACTTAAAGTCTACTTATATCAGATGC
CCTTCATTTTTTGATAAACTTACCAAAGAGCCAATTGCACTCCAGGCTATTGAAAATGCC
CATGTCTTATTATATTTGGGAGACTCTGTCACAACAGATCATATATCACCTGCAGGAAGT
ATCGCTAGGAATAGTGCTGCCGCTAAGTATTTGACAAACAGAGGCCTTACCCCTCGTGAA
TTCAACTCTTACGGAGCTCGAAGAGGTAATGATGCTGTAATGACAAGAGGCACTTTTGCA
AATATCAAGCTTTTTAATAAGTTTATTGGAAAACCAGCTCCTAAAACAATTCATTTTCCA
TCAGGACAGACGCTAGATGTATTTGAGGCTGCAGAGCTGTACCAGAAAGAAGGTATCCCA
CTGATTATTTTAGCAGGAAAGAAATATGGTTCAGGAAACTCCAGAGACTGGGCTGCCAAA
GGACCGTATTTACTGGGTGTGAAAGCTGTTTTGGCCGAAAGTTATGAAAAAATACACAAA
GATCATTTGATTGGAATTGGCATAGCTCCACTTCAGTTCCTTCCAGGAGAAAATGCAGAT
TCCTTGGGCCTCTCCGGTAGAGAAACATTTTCTTTAACATTTCCTGAAGAACTGTCTCCT
GGAATTACATTGAATATACAGACAAGCACTGGAAAAGTATTCAGCGTGATTGCTTCGTTT
GAAGATGATGTGGAAATAACATTATACAAACATGGAGGATTATTAAACTTTGTGGCACGA
AAATTCTCATAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6115
Chromosome Location15
LocusNot Available
References
  1. Samaniego F, Chin J, Iwai K, Rouault TA, Klausner RD: Molecular characterization of a second iron-responsive element binding protein, iron regulatory protein 2. Structure, function, and post-translational regulation. J Biol Chem. 1994 Dec 9;269(49):30904-10. 7983023
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. 16572171
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Rouault TA, Tang CK, Kaptain S, Burgess WH, Haile DJ, Samaniego F, McBride OW, Harford JB, Klausner RD: Cloning of the cDNA encoding an RNA regulatory protein--the human iron-responsive element-binding protein. Proc Natl Acad Sci U S A. 1990 Oct;87(20):7958-62. 2172968
  6. Guo B, Brown FM, Phillips JD, Yu Y, Leibold EA: Characterization and expression of iron regulatory protein 2 (IRP2). Presence of multiple IRP2 transcripts regulated by intracellular iron levels. J Biol Chem. 1995 Jul 14;270(28):16529-35. 7622457
  7. Yamanaka K, Ishikawa H, Megumi Y, Tokunaga F, Kanie M, Rouault TA, Morishima I, Minato N, Ishimori K, Iwai K: Identification of the ubiquitin-protein ligase that recognizes oxidized IRP2. Nat Cell Biol. 2003 Apr;5(4):336-40. 12629548
  8. Vashisht AA, Zumbrennen KB, Huang X, Powers DN, Durazo A, Sun D, Bhaskaran N, Persson A, Uhlen M, Sangfelt O, Spruck C, Leibold EA, Wohlschlegel JA: Control of iron homeostasis by an iron-regulated ubiquitin ligase. Science. 2009 Oct 30;326(5953):718-21. doi: 10.1126/science.1176333. Epub 2009 Sep 17. 19762596
  9. Salahudeen AA, Thompson JW, Ruiz JC, Ma HW, Kinch LN, Li Q, Grishin NV, Bruick RK: An E3 ligase possessing an iron-responsive hemerythrin domain is a regulator of iron homeostasis. Science. 2009 Oct 30;326(5953):722-6. doi: 10.1126/science.1176326. Epub 2009 Sep 17. 19762597
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  11. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648