You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSerine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
Synonyms
  • 3.1.3.16
  • Calcineurin, testis-specific catalytic subunit
  • Calmodulin-dependent calcineurin A subunit gamma isoform
  • CALNA3
  • CAM-PRP catalytic subunit
  • CNA3
Gene NamePPP3CC
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008847|Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
Number of residues512
Molecular Weight58128.865
Theoretical pINot Available
GO Classification
Functions
  • phosphoprotein phosphatase activity
  • metal ion binding
Processes
  • apoptotic process
  • intrinsic apoptotic signaling pathway
  • positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
  • programmed cell death
Components
  • cytosol
  • extracellular exosome
General FunctionPhosphoprotein phosphatase activity
Specific FunctionCalcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP48454
UniProtKB Entry NamePP2BC_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0013452|Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform (PPP3CC)
ATGTCCGGGAGGCGCTTCCACCTCTCCACCACCGACCGCGTCATCAAAGCTGTCCCCTTT
CCTCCAACCCAACGGCTTACTTTCAAGGAAGTATTTGAGAATGGGAAACCTAAAGTTGAT
GTTTTAAAAAACCATTTGGTAAAGGAAGGACGACTGGAAGAGGAAGTAGCCTTAAAGATA
ATCAATGATGGGGCTGCCATCCTGAGGCAAGAGAAGACTATGATAGAAGTAGATGCTCCA
ATCACAGTATGTGGTGATATTCATGGACAATTCTTTGACCTAATGAAGTTATTTGAAGTT
GGAGGATCACCTAGTAACACACGCTACCTCTTTCTGGGTGACTATGTGGACAGAGGCTAT
TTCAGTATAGAGTGTGTGCTGTATTTATGGAGTTTAAAGATTAATCATCCCAAAACATTG
TTTCTGCTTCGGGGAAATCATGAATGCAGGCATCTTACAGACTATTTCACCTTCAAACAG
GAATGTCGAATCAAATATTCGGAACAGGTGTATGATGCCTGTATGGAGACATTTGACTGT
CTTCCTCTTGCTGCCCTCTTAAACCAGCAGTTTCTCTGTGTACATGGAGGAATGTCACCT
GAAATTACTTCTTTAGATGACATTAGGAAATTAGACAGGTTTACGGAACCTCCCGCCTTT
GGACCTGTGTGTGACCTGCTTTGGTCTGATCCCTCAGAGGATTATGGCAATGAGAAGACC
TTGGAGCACTATACCCACAACACTGTCCGAGGGTGCTCTTATTTCTACAGTTACCCTGCA
GTTTGTGAATTTTTGCAGAACAATAATTTACTATCAATTATCAGAGCCCATGAAGCCCAA
GATGCTGGGTATCGAATGTACAGGAAGAGCCAAGCCACAGGCTTTCCATCACTTATTACA
ATTTTCTCTGCCCCCAATTACCTAGATGTCTATAACAATAAAGCTGCTGTGTTGAAATAT
GAAAACAATGTCATGAATATCAGGCAGTTTAACTGTTCTCCACACCCCTACTGGCTTCCA
AACTTTATGGATGTTTTCACATGGTCTTTGCCTTTTGTTGGGGAAAAAGTCACAGAGATG
CTGGTAAATGTGCTCAACATATGCTCTGATGACGAACTGATTTCTGATGATGAAGCAGAA
GATCACTACATTCCAAGCTATCAGAAAGGAAGCACTACAGTTCGTAAGGAGATCATCAGG
AATAAGATCAGAGCCATTGGGAAGATGGCACGGGTCTTTTCAATTCTTCGGCAAGAAAGT
GAGAGTGTGCTGACTCTCAAGGGCCTGACTCCCACAGGCACACTCCCTCTGGGCGTCCTC
TCAGGAGGCAAGCAGACTATCGAGACAGCCACAGTAGAAGCGGTAGAGGCCCGGGAAGCC
ATCAGAGGGTTCTCGCTTCAGCACAAGATCCGGAGTTTTGAAGAAGCGCGAGGTCTGGAC
CGAATTAATGAGCGAATGCCACCCCGAAAGGATAGCATACACGCTGGTGGGCCAATGAAA
TCTGTAACCTCAGCACACTCACATGCTGCGCACAGGAGCGACCAAGGGAAGAAAGCCCAT
TCATGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9316
Chromosome Location8
LocusNot Available
References
  1. Muramatsu T, Kincaid RL: Molecular cloning and chromosomal mapping of the human gene for the testis-specific catalytic subunit of calmodulin-dependent protein phosphatase (calcineurin A). Biochem Biophys Res Commun. 1992 Oct 15;188(1):265-71. 1339277
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. 16421571
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334