You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameG protein-activated inward rectifier potassium channel 4
Synonyms
  • Cardiac inward rectifier
  • CIR
  • GIRK-4
  • GIRK4
  • Heart KATP channel
  • Inward rectifier K(+) channel Kir3.4
  • IRK-4
  • KATP-1
  • Potassium channel, inwardly rectifying subfamily J member 5
Gene NameKCNJ5
OrganismHuman
Amino acid sequence
>lcl|BSEQ0011601|G protein-activated inward rectifier potassium channel 4
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
Number of residues419
Molecular Weight47667.3
Theoretical pI4.96
GO Classification
Functions
  • G-protein activated inward rectifier potassium channel activity
Processes
  • potassium ion import
  • regulation of ion transmembrane transport
  • potassium ion transport
  • synaptic transmission
Components
  • T-tubule
  • plasma membrane
  • voltage-gated potassium channel complex
  • external side of plasma membrane
  • integral component of plasma membrane
General FunctionG-protein activated inward rectifier potassium channel activity
Specific FunctionThis potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.
Pfam Domain Function
Transmembrane Regions87-111 164-185
GenBank Protein ID1055026
UniProtKB IDP48544
UniProtKB Entry NameKCNJ5_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0011602|G protein-activated inward rectifier potassium channel 4 (KCNJ5)
ATGGCTGGCGATTCTAGGAATGCCATGAACCAGGACATGGAGATTGGAGTCACTCCCTGG
GACCCCAAGAAGATTCCAAAACAGGCCCGCGATTATGTCCCCATTGCCACAGACCGTACG
CGCCTGCTGGCCGAGGGCAAGAAGCCACGCCAGCGCTACATGGAGAAGAGTGGCAAGTGC
AACGTGCACCACGGCAACGTCCAGGAGACCTACCGGTACCTGAGTGACCTCTTCACCACC
CTGGTGGACCTCAAGTGGCGCTTCAACTTGCTCGTCTTCACCATGGTTTACACTGTCACC
TGGCTGTTCTTCGGCTTCATTTGGTGGCTCATTGCTTATATCCGGGGTGACCTGGACCAT
GTTGGCGACCAAGAGTGGATTCCTTGTGTTGAAAACCTCAGTGGCTTCGTGTCCGCTTTC
CTGTTCTCCATTGAGACCGAAACAACCATTGGGTATGGCTTCCGAGTCATCACAGAGAAG
TGTCCAGAGGGGATTATACTCCTCTTGGTCCAGGCCATCCTGGGCTCCATCGTCAATGCC
TTCATGGTGGGGTGCATGTTTGTCAAGATCAGCCAGCCCAAGAAGAGAGCGGAGACCCTC
ATGTTTTCCAACAACGCAGTCATCTCCATGCGGGACGAGAAGCTGTGCCTCATGTTCCGG
GTGGGCGACCTCCGCAACTCCCACATCGTGGAGGCCTCCATCCGGGCCAAGCTCATCAAG
TCCCGGCAGACCAAAGAGGGGGAGTTCATCCCCCTGAACCAGACAGACATCAACGTGGGC
TTTGACACGGGCGACGACCGCCTCTTCCTTGTGTCTCCTCTGATCATCTCCCATGAGATC
AACCAGAAGAGCCCTTTCTGGGAGATGTCTCAGGCTCAGCTGCATCAGGAAGAGTTTGAA
GTTGTGGTCATTCTAGAAGGGATGGTGGAAGCCACAGGCATGACCTGCCAAGCCCGGAGC
TCCTACATGGATACAGAGGTGCTCTGGGGCCACCGATTCACACCAGTCCTCACCTTGGAA
AAGGGCTTCTATGAGGTGGACTACAACACCTTCCATGATACCTATGAGACCAACACACCC
AGCTGCTGTGCCAAGGAGCTGGCAGAAATGAAGAGGGAAGGCCGGCTCCTCCAGTACCTC
CCCAGCCCCCCACTGCTGGGGGGCTGTGCTGAGGCAGGGCTGGATGCAGAGGCTGAGCAG
AATGAAGAAGATGAGCCCAAGGGGCTGGGTGGGTCCAGGGAGGCCAGGGGCTCGGTGTGA
GenBank Gene IDU39195
GeneCard IDNot Available
GenAtlas IDKCNJ5
HGNC IDHGNC:6266
Chromosome Location11
Locus11q24
References
  1. Ashford ML, Bond CT, Blair TA, Adelman JP: Cloning and functional expression of a rat heart KATP channel. Nature. 1994 Aug 11;370(6489):456-9. 8047164
  2. Ashford ML, Bond CT, Blair TA, Adelman JP: Cloning and functional expression of a rat heart KATP channel. Nature. 1995 Dec 21-28;378(6559):792. 8524415
  3. Spauschus A, Lentes KU, Wischmeyer E, Dissmann E, Karschin C, Karschin A: A G-protein-activated inwardly rectifying K+ channel (GIRK4) from human hippocampus associates with other GIRK channels. J Neurosci. 1996 Feb 1;16(3):930-8. 8558261
  4. Schoots O, Wilson JM, Ethier N, Bigras E, Hebert TE, Van Tol HH: Co-expression of human Kir3 subunits can yield channels with different functional properties. Cell Signal. 1999 Dec;11(12):871-83. 10659995
  5. Iizuka M, Kubo Y, Tsunenari I, Pan CX, Akiba I, Kono T: Functional characterization and localization of a cardiac-type inwardly rectifying K+ channel. Receptors Channels. 1995;3(4):299-315. 8834003
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  7. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  9. Choi M, Scholl UI, Yue P, Bjorklund P, Zhao B, Nelson-Williams C, Ji W, Cho Y, Patel A, Men CJ, Lolis E, Wisgerhof MV, Geller DS, Mane S, Hellman P, Westin G, Akerstrom G, Wang W, Carling T, Lifton RP: K+ channel mutations in adrenal aldosterone-producing adenomas and hereditary hypertension. Science. 2011 Feb 11;331(6018):768-72. doi: 10.1126/science.1198785. 21311022
  10. Yang Y, Yang Y, Liang B, Liu J, Li J, Grunnet M, Olesen SP, Rasmussen HB, Ellinor PT, Gao L, Lin X, Li L, Wang L, Xiao J, Liu Y, Liu Y, Zhang S, Liang D, Peng L, Jespersen T, Chen YH: Identification of a Kir3.4 mutation in congenital long QT syndrome. Am J Hum Genet. 2010 Jun 11;86(6):872-80. 20560207
  11. Mulatero P, Tauber P, Zennaro MC, Monticone S, Lang K, Beuschlein F, Fischer E, Tizzani D, Pallauf A, Viola A, Amar L, Williams TA, Strom TM, Graf E, Bandulik S, Penton D, Plouin PF, Warth R, Allolio B, Jeunemaitre X, Veglio F, Reincke M: KCNJ5 mutations in European families with nonglucocorticoid remediable familial hyperaldosteronism. Hypertension. 2012 Feb;59(2):235-40. doi: 10.1161/HYPERTENSIONAHA.111.183996. Epub 2011 Dec 27. 22203740
  12. Boulkroun S, Beuschlein F, Rossi GP, Golib-Dzib JF, Fischer E, Amar L, Mulatero P, Samson-Couterie B, Hahner S, Quinkler M, Fallo F, Letizia C, Allolio B, Ceolotto G, Cicala MV, Lang K, Lefebvre H, Lenzini L, Maniero C, Monticone S, Perrocheau M, Pilon C, Plouin PF, Rayes N, Seccia TM, Veglio F, Williams TA, Zinnamosca L, Mantero F, Benecke A, Jeunemaitre X, Reincke M, Zennaro MC: Prevalence, clinical, and molecular correlates of KCNJ5 mutations in primary aldosteronism. Hypertension. 2012 Mar;59(3):592-8. doi: 10.1161/HYPERTENSIONAHA.111.186478. Epub 2012 Jan 23. 22275527
  13. Akerstrom T, Crona J, Delgado Verdugo A, Starker LF, Cupisti K, Willenberg HS, Knoefel WT, Saeger W, Feller A, Ip J, Soon P, Anlauf M, Alesina PF, Schmid KW, Decaussin M, Levillain P, Wangberg B, Peix JL, Robinson B, Zedenius J, Backdahl M, Caramuta S, Iwen KA, Botling J, Stalberg P, Kraimps JL, Dralle H, Hellman P, Sidhu S, Westin G, Lehnert H, Walz MK, Akerstrom G, Carling T, Choi M, Lifton RP, Bjorklund P: Comprehensive re-sequencing of adrenal aldosterone producing lesions reveal three somatic mutations near the KCNJ5 potassium channel selectivity filter. PLoS One. 2012;7(7):e41926. doi: 10.1371/journal.pone.0041926. Epub 2012 Jul 27. 22848660
  14. Scholl UI, Nelson-Williams C, Yue P, Grekin R, Wyatt RJ, Dillon MJ, Couch R, Hammer LK, Harley FL, Farhi A, Wang WH, Lifton RP: Hypertension with or without adrenal hyperplasia due to different inherited mutations in the potassium channel KCNJ5. Proc Natl Acad Sci U S A. 2012 Feb 14;109(7):2533-8. doi: 10.1073/pnas.1121407109. Epub 2012 Jan 30. 22308486