You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameExcitatory amino acid transporter 4
Synonyms
  • EAAT4
  • Sodium-dependent glutamate/aspartate transporter
  • Solute carrier family 1 member 6
Gene NameSLC1A6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004456|Excitatory amino acid transporter 4
MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRNAFIL
LTVSAVVIGVSLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLD
NKATGRMGMRAAVYYMVTTIIAVFIGILMVTIIHPGKGSKEGLHREGRIETIPTADAFMD
LIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENV
TRALGTLQEMLSFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLN
EAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGIVLPL
IYFLVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGA
TVNMDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVL
TSVGLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLG
KPYKSLMAQEKGASRGRGGNESAM
Number of residues564
Molecular Weight61564.875
Theoretical pI9.54
GO Classification
Functions
  • sodium
  • L-aspartate transmembrane transporter activity
  • L-glutamate transmembrane transporter activity
Processes
  • synaptic transmission
  • glutamate secretion
  • neurotransmitter secretion
  • transmembrane transport
  • regulation of membrane potential
  • aspartate transport
  • L-aspartate transmembrane transport
  • L-glutamate transport
  • ion transport
Components
  • membrane
  • plasma membrane
  • Golgi apparatus
  • integral component of plasma membrane
General FunctionSodium:dicarboxylate symporter activity
Specific FunctionTransports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium.
Pfam Domain Function
Transmembrane Regions56-76 99-119 133-153 265-285 306-326 345-365 370-390 418-438 460-480 481-501
GenBank Protein ID930337
UniProtKB IDP48664
UniProtKB Entry NameEAA4_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0011633|Excitatory amino acid transporter 4 (SLC1A6)
ATGAGCAGCCATGGCAACAGCCTGTTCCTGCGGGAGAGCGGCCAGCGGCTGGGCCGGGTG
GGCTGGCTGCAGCGGCTGCAGGAAAGCCTGCAGCAGAGAGCACTGCGCACGCGCCTGCGC
CTGCAGACCATGACCCTCGAGCACGTGCTGCGCTTCCTGCGCCGAAACGCCTTCATTCTG
CTGACGGTCAGCGCCGTGGTCATTGGGGTCAGCCTGGCCTTTGCCCTGCGCCCATATCAG
CTCACCTACCGCCAGATCAAGTACTTCTCTTTTCCTGGAGAGCTTCTGATGAGGATGCTG
CAGATGCTGGTGTTACCTCTCATTGTCTCCAGCCTGGTCACAGGTATGGCATCCCTGGAC
AACAAGGCCACGGGGCGGATGGGGATGCGGGCAGCTGTGTACTACATGGTGACCACCATC
ATCGCGGTCTTCATCGGCATCCTCATGGTCACCATCATCCATCCCGGGAAGGGCTCCAAG
GAGGGGCTGCACCGGGAGGGCCGGATCGAGACCATCCCCACAGCTGATGCCTTCATGGAC
CTGATCAGAAATATGTTTCCACCAAACCTTGTGGAGGCCTGCTTCAAACAGTTCAAGACG
CAGTACAGCACGAGGGTGGTAACCAGGACCATGGTGAGGACAGAGAACGGGTCTGAGCCG
GGTGCCTCCATGCCTCCTCCATTCTCAGTGGAGAACGGAACCAGCTTCCTGGAAAATGTC
ACTCGGGCCTTGGGTACCCTGCAGGAGATGCTGAGCTTTGAGGAGACTGTACCCGTGCCT
GGCTCCGCCAATGGCATCAACGCCCTGGGCCTCGTGGTCTTCTCTGTGGCCTTTGGGCTG
GTCATTGGTGGCATGAAACACAAGGGCAGAGTCCTCAGGGACTTCTTCGACAGCCTCAAT
GAGGCTATTATGAGGCTGGTGGGCATCATTATCTGGTGA
GenBank Gene IDU18244
GeneCard IDNot Available
GenAtlas IDSLC1A6
HGNC IDHGNC:10944
Chromosome Location19
Locus19p13.12
References
  1. Fairman WA, Vandenberg RJ, Arriza JL, Kavanaugh MP, Amara SG: An excitatory amino-acid transporter with properties of a ligand-gated chloride channel. Nature. 1995 Jun 15;375(6532):599-603. 7791878
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334