You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
Name5-hydroxytryptamine receptor 6
Synonyms
  • 5-HT-6
  • Serotonin receptor 6
Gene NameHTR6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010665|5-hydroxytryptamine receptor 6
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
Number of residues440
Molecular Weight46953.625
Theoretical pI9.02
GO Classification
Functions
  • serotonin receptor activity
  • histamine receptor activity
Processes
  • G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
  • cerebral cortex cell migration
  • positive regulation of TOR signaling
  • synaptic transmission
Components
  • cilium
  • plasma membrane
  • integral component of plasma membrane
General FunctionSerotonin receptor activity
Specific FunctionThis is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. It has a high affinity for tricyclic psychotropic drugs (By similarity). Controls pyramidal neurons migration during corticogenesis, through the regulation of CDK5 activity (By similarity). Is an activator of TOR signaling (PubMed:23027611).
Pfam Domain Function
Transmembrane Regions35-57 65-85 101-122 145-166 185-208 266-290 296-320
GenBank Protein ID1162924
UniProtKB IDP50406
UniProtKB Entry Name5HT6R_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010666|5-hydroxytryptamine receptor 6 (HTR6)
ATGGTCCCAGAGCCGGGCCCAACCGCCAATAGCACCCCGGCCTGGGGGGCAGGGCCGCCG
TCGGCCCCGGGGGGCAGCGGCTGGGTGGCGGCCGCGCTGTGCGTGGTCATCGCGCTGACG
GCGGCGGCCAACTCGCTGCTGATCGCGCTCATCTGCACTCAGCCCGCGCTGCGCAACACG
TCCAACTTCTTCCTGGTGTCGCTCTTCACGTCTGACCTGATGGTGGGGCTGGTGGTGATG
CCGCCGGCCATGCTGAACGCGCTGTACGGGCGCTGGGTGCTGGCGCGCGGCCTCTGCCTG
CTCTGGACCGCCTTCGACGTGATGTGCTGCAGCGCCTCCATCCTCAACCTCTGCCTCATC
AGCCTGGACCGCTACCTGCTCATCCTCTCGCCGCTGCGCTACAAGCTGCGCATGACGCCC
CTGCGTGCCCTGGCCCTAGTCCTGGGCGCCTGGAGCCTCGCCGCTCTCGCCTCCTTCCTG
CCCCTGCTGCTGGGCTGGCACGAGCTGGGCCACGCACGGCCACCCGTCCCTGGCCAGTGC
CGCCTGCTGGCCAGCCTGCCTTTTGTCCTTGTGGCGTCGGGCCTCACCTTCTTCCTGCCC
TCGGGTGCCATATGCTTCACCTACTGCAGGATCCTGCTAGCTGCCCGCAAGCAGGCCGTG
CAGGTGGCCTCCCTCACCACCGGCATGGCCAGTCAGGCCTCGGAGACGCTGCAGGTGCCC
AGGACCCCACGCCCAGGGGTGGAGTCTGCTGACAGCAGGCGTCTAGCCACGAAGCACAGC
AGGAAGGCCCTGAAGGCCAGCCTGACGCTGGGCATCCTGCTGGGCATGTTCTTTGTGACC
TGGTTGCCCTTCTTTGTGGCCAACATAGTCCAGGCCGTGTGCGACTGCATCTCCCCAGGC
CTCTTCGATGTCCTCACATGGCTGGGTTACTGTAACAGCACCATGAACCCCATCATCTAC
CCACTCTTCATGCGGGACTTCAAGCGGGCGCTGGGCAGGTTCCTGCCATGTCCACGCTGT
CCCCGGGAGCGCCAGGCCAGCCTGGCCTCGCCATCACTGCGCACCTCTCACAGCGGCCCC
CGGCCCGGCCTTAGCCTACAGCAGGTGCTGCCGCTGCCCCTGCCGCCGGACTCAGATTCG
GACTCAGACGCAGGCTCAGGCGGCTCCTCGGGCCTGCGGCTCACGGCCCAGCTGCTGCTT
CCTGGCGAGGCCACCCAGGACCCCCCGCTGCCCACCAGGGCCGCTGCCGCCGTCAATTTC
TTCAACATCGACCCCGCGGAGCCCGAGCTGCGGCCGCATCCACTTGGCATCCCCACGAAC
TGA
GenBank Gene IDL41147
GeneCard IDNot Available
GenAtlas IDHTR6
HGNC IDHGNC:5301
Chromosome Location1
Locus1p36-p35
References
  1. Kohen R, Metcalf MA, Khan N, Druck T, Huebner K, Lachowicz JE, Meltzer HY, Sibley DR, Roth BL, Hamblin MW: Cloning, characterization, and chromosomal localization of a human 5-HT6 serotonin receptor. J Neurochem. 1996 Jan;66(1):47-56. 8522988
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Ullmer C, Schmuck K, Kalkman HO, Lubbert H: Expression of serotonin receptor mRNAs in blood vessels. FEBS Lett. 1995 Aug 21;370(3):215-21. 7656980
  5. Meffre J, Chaumont-Dubel S, Mannoury la Cour C, Loiseau F, Watson DJ, Dekeyne A, Seveno M, Rivet JM, Gaven F, Deleris P, Herve D, Fone KC, Bockaert J, Millan MJ, Marin P: 5-HT(6) receptor recruitment of mTOR as a mechanism for perturbed cognition in schizophrenia. EMBO Mol Med. 2012 Oct;4(10):1043-56. doi: 10.1002/emmm.201201410. 23027611