You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTubulin alpha chain
SynonymsNot Available
Gene NameNot Available
OrganismBarber pole worm
Amino acid sequence
>lcl|BSEQ0020849|Tubulin alpha chain
MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGCDDSFSTFFSETGSGR
HVPRAVMIDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYTIGKEIIDLTLD
RIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSVYPAPQVSTA
VVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHN
QMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSLEDNGEEGDEY
Number of residues450
Molecular Weight50110.195
Theoretical pINot Available
GO Classification
Functions
  • GTPase activity
  • structural constituent of cytoskeleton
  • GTP binding
Processes
  • microtubule-based process
Components
  • microtubule
  • cytoplasm
General FunctionStructural constituent of cytoskeleton
Specific FunctionTubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP50719
UniProtKB Entry NameTBA_HAECO
Cellular LocationCytoplasm
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Klein RD, Nulf SC, Alexander-Bowman SJ, Mainone CB, Winterrowd CA, Geary TG: Cloning of a cDNA encoding alpha-tubulin from Haemonchus contortus. Mol Biochem Parasitol. 1992 Dec;56(2):345-8. 1484557