You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGastrotropin
Synonyms
  • Fatty acid-binding protein 6
  • GT
  • I-15P
  • I-BABP
  • ILBP
  • Ileal lipid-binding protein
  • ILLBP
  • Intestinal 15 kDa protein
  • Intestinal bile acid-binding protein
Gene NameFABP6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0003897|Gastrotropin
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTM
TNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTY
ERVSKRLA
Number of residues128
Molecular Weight14371.245
Theoretical pI6.81
GO Classification
Functions
  • bile acid binding
  • transporter activity
  • lipid binding
Processes
  • negative regulation of cell proliferation
  • lipid metabolic process
  • bile acid metabolic process
  • bile acid and bile salt transport
  • triglyceride catabolic process
  • small molecule metabolic process
Components
  • cytoplasm
  • cytosol
General FunctionTransporter activity
Specific FunctionIleal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins. Isoform 2 is essential for the survival of colon cancer cells to bile acid-induced apoptosis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID894183
UniProtKB IDP51161
UniProtKB Entry NameFABP6_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0016631|Gastrotropin (FABP6)
ATGAAGACAGTGACGATGATGATGGTGGTGGAGATGCAGGCGCTGACTCAGGTTCTGAGA
GCTGTGTTGTCTGCGTGCACATGGGTGAGCCGGAAAGGAGACCTGCAGAGAATGAAACAG
ACACATAAAGGAAAGCCTCCCAGCAGCATGGCTTTCACCGGCAAGTTCGAGATGGAGAGT
GAGAAGAATTATGATGAGTTCATGAAGCTCCTTGGGATCTCCAGCGATGTAATCGAAAAG
GCCCGCAACTTCAAGATCGTCACGGAGGTGCAGCAGGATGGGCAGGACTTCACTTGGTCC
CAGCACTACTCCGGGGGCCACACCATGACCAACAAGTTCACTGTTGGCAAGGAAAGCAAC
ATACAGACAATGGGGGGCAAGACGTTCAAGGCCACTGTGCAGATGGAGGGCGGGAAGCTG
GTGGTGAATTTCCCCAACTATCACCAGACCTCAGAGATCGTGGGTGACAAGCTGGTGGAG
GTCTCCACCATCGGAGGCGTGACCTATGAGCGCGTGAGCAAGAGACTGGCCTAA
GenBank Gene IDU19869
GeneCard IDNot Available
GenAtlas IDFABP6
HGNC IDHGNC:3561
Chromosome Location5
Locus5q33.3-q34
References
  1. Oelkers P, Dawson PA: Cloning and chromosomal localization of the human ileal lipid-binding protein. Biochim Biophys Acta. 1995 Jul 13;1257(2):199-202. 7619861
  2. Fujita M, Fujii H, Kanda T, Sato E, Hatakeyama K, Ono T: Molecular cloning, expression, and characterization of a human intestinal 15-kDa protein. Eur J Biochem. 1995 Oct 15;233(2):406-13. 7588781
  3. Fang C, Dean J, Smith JW: A novel variant of ileal bile acid binding protein is up-regulated through nuclear factor-kappaB activation in colorectal adenocarcinoma. Cancer Res. 2007 Oct 1;67(19):9039-46. 17909007
  4. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. 15372022
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Kurz M, Brachvogel V, Matter H, Stengelin S, Thuring H, Kramer W: Insights into the bile acid transportation system: the human ileal lipid-binding protein-cholyltaurine complex and its comparison with homologous structures. Proteins. 2003 Feb 1;50(2):312-28. 12486725