You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameP2Y purinoceptor 4
Synonyms
  • NRU
  • P2P
  • P2Y4
  • UNR
  • Uridine nucleotide receptor
Gene NameP2RY4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017730|P2Y purinoceptor 4
MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY
CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG
TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR
LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP
RADRL
Number of residues365
Molecular Weight40962.49
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
  • G-protein coupled purinergic nucleotide receptor activity
  • UTP-activated nucleotide receptor activity
  • uridine nucleotide receptor activity
Processes
  • positive regulation of cytosolic calcium ion concentration
  • phospholipase C-activating G-protein coupled receptor signaling pathway
  • cellular response to prostaglandin E stimulus
  • transepithelial chloride transport
Components
  • plasma membrane
  • cytosol
  • integral component of plasma membrane
  • basolateral plasma membrane
  • apical plasma membrane
General FunctionUtp-activated nucleotide receptor activity
Specific FunctionReceptor for UTP and UDP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. Not activated by ATP or ADP.
Pfam Domain Function
Transmembrane Regions35-61 73-95 113-131 155-174 197-222 247-269 288-309
GenBank Protein IDNot Available
UniProtKB IDP51582
UniProtKB Entry NameP2RY4_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0017731|P2Y purinoceptor 4 (P2RY4)
ATGGCCAGTACAGAGTCCTCCCTGTTGAGATCCCTAGGCCTCAGCCCAGGTCCTGGCAGC
AGTGAGGTGGAGCTGGACTGTTGGTTTGATGAGGATTTCAAGTTCATCCTGCTGCCTGTG
AGCTATGCAGTTGTCTTTGTGCTGGGCTTGGGCCTTAACGCCCCAACCCTATGGCTCTTC
ATCTTCCGCCTCCGACCCTGGGATGCAACGGCCACCTACATGTTCCACCTGGCATTGTCA
GACACCTTGTATGTGCTGTCGCTGCCCACCCTCATCTACTATTATGCAGCCCACAACCAC
TGGCCCTTTGGCACTGAGATCTGCAAGTTCGTCCGCTTTCTTTTCTATTGGAACCTCTAC
TGCAGTGTCCTTTTCCTCACCTGCATCAGCGTGCACCGCTACCTGGGCATCTGCCACCCA
CTTCGGGCACTACGCTGGGGCCGCCCTCGCCTCGCAGGCCTTCTCTGCCTGGCAGTTTGG
TTGGTCGTAGCCGGCTGCCTCGTGCCCAACCTGTTCTTTGTCACAACCAGCAACAAAGGG
ACCACCGTCCTGTGCCATGACACCACTCGGCCTGAAGAGTTTGACCACTATGTGCACTTC
AGCTCGGCGGTCATGGGGCTGCTCTTTGGCGTGCCCTGCCTGGTCACTCTTGTTTGCTAT
GGACTCATGGCTCGTCGCCTGTATCAGCCCTTGCCAGGCTCTGCACAGTCGTCTTCTCGC
CTCCGCTCTCTCCGCACCATAGCTGTGGTGCTGACTGTCTTTGCTGTCTGCTTCGTGCCT
TTCCACATCACCCGCACCATTTACTACCTGGCCAGGCTGTTGGAAGCTGACTGCCGAGTA
CTGAACATTGTCAACGTGGTCTATAAAGTGACTCGGCCCCTGGCCAGTGCCAACAGCTGC
CTGGATCCTGTGCTCTACTTGCTCACTGGGGACAAATATCGACGTCAGCTCCGTCAGCTC
TGTGGTGGTGGCAAGCCCCAGCCCCGCACGGCTGCCTCTTCCCTGGCACTAGTGTCCCTG
CCTGAGGATAGCAGCTGCAGGTGGGCGGCCACCCCCCAGGACAGTAGCTGCTCTACTCCT
AGGGCAGATAGATTGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:8542
Chromosome LocationX
LocusNot Available
References
  1. Communi D, Pirotton S, Parmentier M, Boeynaems JM: Cloning and functional expression of a human uridine nucleotide receptor. J Biol Chem. 1995 Dec 29;270(52):30849-52. 8537336
  2. Nguyen T, Erb L, Weisman GA, Marchese A, Heng HH, Garrad RC, George SR, Turner JT, O'Dowd BF: Cloning, expression, and chromosomal localization of the human uridine nucleotide receptor gene. J Biol Chem. 1995 Dec 29;270(52):30845-8. 8537335
  3. Stam NJ, Klomp J, Van de Heuvel N, Olijve W: Molecular cloning and characterization of a novel orphan receptor (P2P) expressed in human pancreas that shows high structural homology to the P2U purinoceptor. FEBS Lett. 1996 Apr 22;384(3):260-4. 8617367
  4. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. 15772651
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Brinson AE, Harden TK: Differential regulation of the uridine nucleotide-activated P2Y4 and P2Y6 receptors. SER-333 and SER-334 in the carboxyl terminus are involved in agonist-dependent phosphorylation desensitization and internalization of the P2Y4 receptor. J Biol Chem. 2001 Apr 13;276(15):11939-48. Epub 2000 Dec 12. 11114308