You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameH(+)/Cl(-) exchange transporter 4
Synonyms
  • Chloride channel protein 4
  • Chloride transporter ClC-4
  • ClC-4
Gene NameCLCN4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009061|H(+)/Cl(-) exchange transporter 4
MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEF
IKSLLDAWSGWVVMLLIGLLAGTLAGVIDLAVDWMTDLKEGVCLSAFWYSHEQCCWTSNE
TTFEDRDKCPLWQKWSELLVNQSEGASAYILNYLMYILWALLFAFLAVSLVRVFAPYACG
SGIPEIKTILSGFIIRGYLGKWTLLIKTVTLVLVVSSGLSLGKEGPLVHVACCCGNFFSS
LFSKYSKNEGKRREVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALV
AAFTLRSINPFGNSRLVLFYVEYHTPWYMAELFPFILLGVFGGLWGTLFIRCNIAWCRRR
KTTRLGKYPVLEVIVVTAITAIIAYPNPYTRQSTSELISELFNDCGALESSQLCDYINDP
NMTRPVDDIPDRPAGVGVYTAMWQLALALIFKIVVTIFTFGMKIPSGLFIPSMAVGAIAG
RMVGIGVEQLAYHHHDWIIFRNWCRPGADCVTPGLYAMVGAAACLGGVTRMTVSLVVIMF
ELTGGLEYIVPLMAAAVTSKWVADAFGKEGIYEAHIHLNGYPFLDVKDEFTHRTLATDVM
RPRRGEPPLSVLTQDSMTVEDVETLIKETDYNGFPVVVSRDSERLIGFAQRRELILAIKN
ARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLSPFTVTDHTPMETVVDIFRKL
GLRQCLVTRSGRLLGIITKKDVLRHMAQMANQDPESIMFN
Number of residues760
Molecular Weight84915.965
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
  • chloride channel activity
  • voltage-gated chloride channel activity
  • antiporter activity
Processes
  • ion transmembrane transport
  • chloride transmembrane transport
  • regulation of anion transmembrane transport
  • transport
  • chloride transport
  • transmembrane transport
Components
  • early endosome membrane
  • endosome membrane
  • late endosome membrane
  • integral component of membrane
General FunctionVoltage-gated chloride channel activity
Specific FunctionProton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons.
Pfam Domain Function
Transmembrane Regions68-105 151-174 200-218 224-243 291-309 333-358 365-385 442-462 467-486 548-566
GenBank Protein IDNot Available
UniProtKB IDP51793
UniProtKB Entry NameCLCN4_HUMAN
Cellular LocationEarly endosome membrane
Gene sequence
>lcl|BSEQ0013591|H(+)/Cl(-) exchange transporter 4 (CLCN4)
ATGACGGACCTGAAGGAGGGGGTCTGCCTGTCTGCCTTCTGGTATAGCCATGAGCAGTGT
TGCTGGACTTCTAACGAGACCACTTTTGAGGACAGAGACAAGTGTCCCCTGTGGCAGAAA
TGGTCGGAGCTGCTGGTGAATCAGTCAGAGGGTGCCAGTGCTTACATTCTGAATTACTTA
ATGTACATCCTATGGGCGCTGCTGTTTGCATTTTTGGCTGTCTCCCTGGTGCGTGTATTT
GCACCATATGCCTGTGGCTCTGGCATACCAGAGATAAAGACCATTTTGAGCGGCTTTATC
ATCAGGGGCTACTTGGGGAAGTGGACCCTGCTAATCAAGACAGTCACGCTGGTGCTGGTA
GTGTCCTCCGGTCTGAGCCTTGGGAAGGAAGGGCCGCTAGTGCACGTGGCTTGTTGCTGT
GGCAACTTCTTCAGCAGCCTTTTCTCCAAGTACAGCAAGAATGAGGGCAAGAGGCGGGAG
GTGCTTTCAGCTGCAGCGGCTGCTGGAGTCTCTGTTGCCTTTGGTGCACCAATTGGAGGC
GTGCTTTTCAGTCTAGAAGAGGTCAGTTACTACTTTCCCCTGAAGACCTTGTGGAGGTCA
TTTTTCGCAGCCCTGGTGGCGGCCTTTACGCTGAGATCCATCAATCCCTTTGGGAATAGC
CGTCTCGTTCTCTTTTATGTGGAATACCACACGCCCTGGTACATGGCTGAACTCTTCCCC
TTCATCCTGCTTGGGGTCTTCGGGGGCTTGTGGGGAACCCTCTTCATCCGCTGCAACATC
GCCTGGTGCAGGAGGCGCAAGACCACCAGGCTGGGGAAGTACCCGGTGCTGGAGGTCATT
GTGGTGACTGCCATCACTGCCATCATTGCCTACCCCAATCCCTACACACGCCAGAGCACC
AGCGAGCTCATTTCTGAGCTGTTCAATGACTGTGGAGCCCTTGAGTCTTCCCAGCTCTGT
GACTACATCAATGACCCCAACATGACTCGGCCTGTGGATGACATTCCAGACCGGCCGGCT
GGTGTCGGTGTTTACACGGCCATGTGGCAGCTGGCCCTGGCACTGATCTTCAAAATCGTC
GTTACCATATTTACCTTTGGCATGAAGATCCCGTCGGGCCTCTTCATCCCCAGCATGGCT
GTGGGCGCGATAGCGGGCAGGATGGTGGGAATTGGCGTGGAGCAGCTGGCCTACCATCAC
CATGACTGGATCATCTTCAGGAACTGGTGCAGACCCGGTGCAGACTGTGTCACGCCAGGG
CTGTACGCAATGGTGGGAGCTGCGGCCTGCCTCGGTGGAGTTACCAGGATGACGGTGTCA
TTGGTGGTCATCATGTTTGAATTAACCGGGGGTCTGGAGTACATCGTGCCCCTGATGGCG
GCGGCTGTGACCAGCAAGTGGGTAGCTGATGCATTTGGGAAAGAAGGCATCTACGAGGCC
CACATCCACTTAAATGGGTACCCTTTCCTTGACGTGAAGGACGAGTTTACTCACCGCACA
CTGGCCACCGACGTCATGCGGCCCCGGCGGGGAGAGCCGCCACTGTCGGTGCTCACCCAG
GACAGCATGACTGTCGAGGACGTGGAGACGCTCATCAAGGAGACCGACTACAACGGCTTC
CCCGTGGTGGTCTCCAGAGACTCCGAGCGCCTCATTGGATTTGCCCAGAGGAGGGAACTG
ATTCTCGCAATAAAGAACGCCAGACAGAGGCAGGAGGGCATTGTGAGCAATTCCATCATG
TACTTCACGGAGGAACCCCCCGAGCTGCCGGCCAACAGCCCACATCCCCTGAAGCTGCGG
CGCATCCTGAACCTCAGCCCGTTTACAGTGACAGACCACACTCCGATGGAAACGGTGGTG
GATATCTTCCGGAAACTGGGGCTTCGGCAGTGCCTGGTGACGCGGAGCGGGAGACTTCTT
GGCATCATCACAAAAAAGGATGTTCTGAGACATATGGCCCAGATGGCAAACCAGGACCCC
GAATCCATCATGTTTAATTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2022
Chromosome LocationX
LocusNot Available
References
  1. van Slegtenhorst MA, Bassi MT, Borsani G, Wapenaar MC, Ferrero GB, de Conciliis L, Rugarli EI, Grillo A, Franco B, Zoghbi HY, Ballabio A: A gene from the Xp22.3 region shares homology with voltage-gated chloride channels. Hum Mol Genet. 1994 Apr;3(4):547-52. 8069296
  2. Kawasaki M, Fukuma T, Yamauchi K, Sakamoto H, Marumo F, Sasaki S: Identification of an acid-activated Cl(-) channel from human skeletal muscles. Am J Physiol. 1999 Nov;277(5 Pt 1):C948-54. 10564087
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. 15772651
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Zdebik AA, Zifarelli G, Bergsdorf EY, Soliani P, Scheel O, Jentsch TJ, Pusch M: Determinants of anion-proton coupling in mammalian endosomal CLC proteins. J Biol Chem. 2008 Feb 15;283(7):4219-27. Epub 2007 Dec 6. 18063579