You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameChloride transport protein 6
Synonyms
  • Chloride channel protein 6
  • ClC-6
  • KIAA0046
Gene NameCLCN6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009055|Chloride transport protein 6
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYESLDYDRCINDP
YLEVLETMDNKKGRRYEAVKWMVVFAIGVCTGLVGLFVDFFVRLFTQLKFGVVQTSVEEC
SQKGCLALSLLELLGFNLTFVFLASLLVLIEPVAAGSGIPEVKCYLNGVKVPGIVRLRTL
LCKVLGVLFSVAGGLFVEKEGPMIHSGSVVGAGLPQFQSISLRKIQFNFPYFRSDRDKRD
FVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKVLFCSMSATFTLNFFRSGIQF
GSWGSFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNCLNKRLAK
YRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECRQMSSSSQIGNDSFQLQVTED
VNSSIKTFFCPNDTYNDMATLFFNPQESAILQLFHQDGTFSPVTLALFFVLYFLLACWTY
GISVPSGLFVPSLLCGAAFGRLVANVLKSYIGLGHIYSGTFALIGAAAFLGGVVRMTISL
TVILIESTNEITYGLPIMVTLMVAKWTGDFFNKGIYDIHVGLRGVPLLEWETEVEMDKLR
ASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFK
KSSILTRAGEQRKRSQSMKSYPSSELRNMCDEHIASEEPAEKEDLLQQMLERRYTPYPNL
YPDQSPSEDWTMEERFRPLTFHGLILRSQLVTLLVRGVCYSESQSSASQPRLSYAEMAED
YPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNA
VGEIVGIITRHNLTYEFLQARLRQHYQTI
Number of residues869
Molecular Weight97287.84
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
  • voltage-gated chloride channel activity
  • antiporter activity
Processes
  • regulation of anion transmembrane transport
  • signal transduction
  • chloride transport
  • transmembrane transport
  • ion transmembrane transport
  • cell volume homeostasis
  • response to mechanical stimulus
Components
  • integral component of membrane
  • lysosomal membrane
  • endosome membrane
General FunctionVoltage-gated chloride channel activity
Specific FunctionChloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.
Pfam Domain Function
Transmembrane Regions81-113 128-150 176-194 200-217 277-294 335-364 371-392 462-481 487-511 553-571
GenBank Protein IDNot Available
UniProtKB IDP51797
UniProtKB Entry NameCLCN6_HUMAN
Cellular LocationEndosome membrane
Gene sequence
>lcl|BSEQ0013588|Chloride transport protein 6 (CLCN6)
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAG
CGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGAT
GAGATTCTTCCAAGGAAAGACTATGAGAAAGGTCGAAGATATGAGGCGGTGAAGTGGATG
GTGGTGTTTGCCATTGGAGTCTGCACTGGCCTGGTGGGTCTCTTTGTGGACTTTTTTGTG
CGACTCTTCACCCAACTCAAGTTCGGAGTGGTACAGACATCGGTGGAGGAGTGCAGCCAG
AAAGGCTGCCTCGCTCTGTCTCTCCTTGAACTCCTGGGTTTTAACCTCACCTTTGTCTTC
CTGGCAAGCCTCCTTGTTCTCATTGAGCCGGTGGCAGCAGGTTCCGGGATACCCGAGGTC
AAATGCTATCTGAATGGCGTAAAGGTGCCAGGAATCGTCCGTCTCCGGACCCTGCTCTGC
AAGGTCCTTGGAGTGCTGTTCAGTGTGGCTGGAGGGCTCTTCGTGGGGAAGGAAGGCCCC
ATGATCCACAGTGGTTCGGTGGTGGGAGCTGGCCTCCCTCAGTTTCAGAGCATCTCCTTA
CGGAAGATCCAGTTTAACTTCCCCTATTTCCGAAGCGACAGAGACAAGAGAGACTTTGTA
TCAGCAGGAGCGGCTGCTGGAGTTGCTGCAGCTTTCGGGGCGCCAATCGGGGGTACCTTG
TTCAGTCTAGAGGAGGGTTCGTCCTTCTGGAACCAAGGGCTCACGTGGAAAGTGCTCTTT
TGTTCCATGTCTGCCACCTTCACCCTCAACTTCTTCCGTTCTGGGATTCAGTTTGGAAGC
TGGGGTTCCTTCCAGCTCCCTGGATTGCTGAACTTTGGCGAGTTTAAGTGCTCTGACTCT
GATAAAAAATGTCATCTCTGGACAGCTATGGATTTGGGTTTCTTCGTCGTGATGGGGGTC
ATTGGGGGCCTCCTGGGAGCCACATTCAACTGTCTGAACAAGAGGCTTGCAAAGTACCGT
ATGCGAAACGTGCACCCGAAACCTAAGCTCGTCAGAGTCTTAGAGAGCCTCCTTGTGTCT
CTGGTAACCACCGTGGTGGTGTTTGTGGCCTCGATGGTGTTAGGAGAATGCCGACAGATG
TCCTCTTCGAGTCAAATCGGTAATGACTCATTCCAGCTCCAGGTCACAGAAGATGTGAAT
TCAAGTATCAAGACATTTTTTTGTCCCAATGATACCTACAATGACATGGCCACACTCTTC
TTCAACCCGCAGGAGTCTGCCATCCTCCAGCTCTTCCACCAGGATGGTACTTTCAGCCCC
GTCACTCTGGCCTTGTTCTTCGTTCTCTATTTCTTGCTTGCATGTTGGACTTACGGCATT
TCTGTTCCAAGTGGCCTTTTTGTGCCTTCTCTGCTGTGTGGAGCTGCTTTTGGACGTTTA
GTTGCCAATGTCCTAAAAAGCTACATTGGATTGGGCCACATCTATTCGGGGACCTTTGCC
CTGATTGGTGCAGCGGCTTTCTTGGGCGGGGTGGTCCGCATGACCATCAGCCTCACGGTC
ATCCTGATCGAGTCCACCAATGAGATCACCTACGGGCTCCCCATCATGGTCACACTGATG
GTGGCCAAATGGACAGGGGACTTTTTCAATAAGGGCATTTATGATATCCACGTGGGCCTG
CGAGGCGTGCCGCTTCTGGAATGGGAGACAGAGGTGGAAATGGACAAGCTGAGAGCCAGC
GACATCATGGAGCCCAACCTGACCTACGTCTACCCGCACACCCGCATCCAGTCTCTGGTG
AGCATCCTGCGCACCACGGTCCACCATGCCTTCCCGGTGGTCACAGAGAACCGCGGTAAC
GAGAAGGAGTTCATGAAGGGCAACCAGCTCATCAGCAACAACATCAAGTTCAAGAAATCC
AGCATCCTCACCCGGGCTGGCGAGCAGCGCAAACGGAGCCAGTCCATGAAGTCCTACCCA
TCCAGCGAGCTACGGAACATGTGTGATGAGCACATCGCCTCTGAGGAGCCAGCCGAGAAG
GAGGACCTCCTGCAGCAGATGCTGGAAAGGAGATACACTCCCTACCCCAACCTATACCCT
GACCAGTCCCCAAGTGAAGACTGGACCATGGAGGAGCGGTTCCGCCCTCTGACCTTCCAC
GGCCTGATCCTTCGGTCGCAGCTTGTCACCCTGCTTGTCCGAGGAGTTTGTTACTCTGAA
AGCCAGTCGAGCGCCAGCCAGCCGCGCCTCTCCTATGCCGAGATGGCCGAGGACTACCCG
CGGTACCCCGACATCCACGACCTGGACCTGACGCTGCTCAACCCGCGCATGATCGTGGAT
GTCACCCCATACATGAACCCTTCGCCTTTCACCGTCTCGCCCAACACCCACGTCTCCCAA
GTCTTCAACCTGTTCAGAACGATGGGCCTGCGCCACCTGCCCGTGGTGAACGCTGTGGGA
GAGATCGTGGGGATCATCACACGGCACAACCTCACCTATGAATTTCTGCAGGCCCGGCTG
AGGCAGCACTACCAGACCATCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2024
Chromosome Location1
LocusNot Available
References
  1. Brandt S, Jentsch TJ: ClC-6 and ClC-7 are two novel broadly expressed members of the CLC chloride channel family. FEBS Lett. 1995 Dec 11;377(1):15-20. 8543009
  2. Eggermont J, Buyse G, Voets T, Tytgat J, De Smedt H, Droogmans G, Nilius B: Alternative splicing of ClC-6 (a member of the CIC chloride-channel family) transcripts generates three truncated isoforms one of which, ClC-6c, is kidney-specific. Biochem J. 1997 Jul 1;325 ( Pt 1):269-76. 9224655
  3. Kornak U, Bosl MR, Kubisch C: Complete genomic structure of the CLCN6 and CLCN7 putative chloride channel genes(1). Biochim Biophys Acta. 1999 Oct 6;1447(1):100-6. 10500249
  4. Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1994;1(5):223-9. 7584044
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. 12168954
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  7. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  9. Lamb FS, Clayton GH, Liu BX, Smith RL, Barna TJ, Schutte BC: Expression of CLCN voltage-gated chloride channel genes in human blood vessels. J Mol Cell Cardiol. 1999 Mar;31(3):657-66. 10198195
  10. Ignoul S, Simaels J, Hermans D, Annaert W, Eggermont J: Human ClC-6 is a late endosomal glycoprotein that associates with detergent-resistant lipid domains. PLoS One. 2007 May 30;2(5):e474. 17534424