You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameRibonuclease UK114
Synonyms
  • 14.5 kDa translational inhibitor protein
  • 3.1.-.-
  • Heat-responsive protein 12
  • p14.5
  • PSP
  • UK114 antigen homolog
Gene NameHRSP12
OrganismHuman
Amino acid sequence
>lcl|BSEQ0011180|Ribonuclease UK114
MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALK
NMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSR
IEIEAVAIQGPLTTASL
Number of residues137
Molecular Weight14493.53
Theoretical pI9.01
GO Classification
Functions
  • poly(A) RNA binding
  • transition metal ion binding
  • long-chain fatty acid binding
  • platinum binding
  • xenon atom binding
  • deaminase activity
  • endoribonuclease activity, producing 3'-phosphomonoesters
Processes
  • lung development
  • kidney development
  • brain development
  • G1 to G0 transition
  • response to lipid
  • negative regulation of epithelial cell proliferation
  • negative regulation of translation
  • regulation of translational termination
  • response to salt
Components
  • extracellular exosome
  • cytoplasm
  • mitochondrion
  • nucleus
  • peroxisome
  • cytosol
General FunctionXenon atom binding
Specific FunctionEndoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID1177435
UniProtKB IDP52758
UniProtKB Entry NameUK114_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0011181|Ribonuclease UK114 (HRSP12)
ATGTCGTCCTTGATCAGAAGGGTGATCAGCACCGCGAAAGCCCCAGGGGCCATTGGACCC
TACAGTCAAGCTGTATTAGTCGACAGGACCATTTACATTTCAGGACAGATAGGCATGGAC
CCTTCAAGTGGACAGCTTGTGTCAGGAGGGGTAGCAGAAGAAGCTAAACAAGCTCTTAAA
AACATGGGTGAAATTCTGAAAGCTGCAGGCTGTGACTTCACTAACGTGGTGAAAACAACT
GTTCTTCTGGCTGACATAAATGACTTCAATACTGTCAATGAAATCTACAAACAGTATTTC
AAGAGTAATTTTCCTGCTAGAGCTGCTTACCAAGTTGCTGCTTTACCCAAAGGCAGCCGA
ATTGAAATTGAAGCAGTAGCTATCCAAGGACCACTGACAACGGCATCACTATAA
GenBank Gene IDX95384
GeneCard IDNot Available
GenAtlas IDHRSP12
HGNC IDHGNC:16897
Chromosome Location8
Locus8q22
References
  1. Schmiedeknecht G, Kerkhoff C, Orso E, Stohr J, Aslanidis C, Nagy GM, Knuechel R, Schmitz G: Isolation and characterization of a 14.5-kDa trichloroacetic-acid-soluble translational inhibitor protein from human monocytes that is upregulated upon cellular differentiation. Eur J Biochem. 1996 Dec 1;242(2):339-51. 8973653
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  4. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  5. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  6. Manjasetty BA, Delbruck H, Pham DT, Mueller U, Fieber-Erdmann M, Scheich C, Sievert V, Bussow K, Niesen FH, Weihofen W, Loll B, Saenger W, Heinemann U: Crystal structure of Homo sapiens protein hp14.5. Proteins. 2004 Mar 1;54(4):797-800. 14997576