You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameP2X purinoceptor 3
Synonyms
  • ATP receptor
  • P2X3
  • Purinergic receptor
Gene NameP2RX3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013731|P2X purinoceptor 3
MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
Number of residues397
Molecular Weight44288.65
Theoretical pINot Available
GO Classification
Functions
  • extracellular ATP-gated cation channel activity
  • purinergic nucleotide receptor activity
  • ATP binding
Processes
  • peristalsis
  • neuromuscular synaptic transmission
  • positive regulation of calcium ion transport into cytosol
  • sensory perception of taste
  • neuronal action potential
  • purinergic nucleotide receptor signaling pathway
  • response to mechanical stimulus
  • urinary bladder smooth muscle contraction
  • protein homooligomerization
  • transport
  • signal transduction
  • regulation of synaptic plasticity
  • response to ATP
  • response to heat
  • response to cold
  • positive regulation of calcium-mediated signaling
  • behavioral response to pain
  • response to hypoxia
  • response to carbohydrate
Components
  • membrane raft
  • integral component of nuclear inner membrane
  • neuronal cell body
  • dendritic spine
  • terminal bouton
  • receptor complex
  • Golgi apparatus
  • rough endoplasmic reticulum
  • integral component of plasma membrane
General FunctionPurinergic nucleotide receptor activity
Specific FunctionReceptor for ATP that acts as a ligand-gated ion channel.
Pfam Domain Function
Transmembrane Regions23-43 318-338
GenBank Protein IDNot Available
UniProtKB IDP56373
UniProtKB Entry NameP2RX3_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013732|P2X purinoceptor 3 (P2RX3)
ATGAACTGCATATCCGACTTCTTCACCTATGAGACCACCAAGTCGGTGGTTGTGAAGAGC
TGGACCATCGGGATCATCAACCGAGTAGTTCAGCTTCTGATCATCTCCTACTTTGTAGGG
TGGGTTTTCTTGCACGAGAAGGCTTACCAGGTACGGGACACAGCCATTGAGTCCTCGGTG
GTAACCAAGGTGAAGGGCTCCGGACTCTACGCCAACAGAGTCATGGATGTGTCTGATTAC
GTGACGCCACCTCAGGGCACCTCGGTCTTTGTCATCATCACCAAGATGATTGTTACTGAA
AATCAGATGCAAGGATTCTGCCCAGAGAGTGAGGAGAAATACCGCTGTGTATCAGACAGC
CAGTGCGGGCCTGAGCGCTTGCCAGGTGGGGGGATCCTCACTGGCCGCTGCGTGAACTAC
AGCTCTGTGCTCCGGACCTGTGAGATCCAGGGCTGGTGCCCCACGGAGGTGGACACAGTG
GAAACGCCCATCATGATGGAAGCTGAGAACTTCACTATTTTCATCAAGAACAGCATCCGT
TTCCCCCTCTTCAACTTTGAGAAGGGAAACCTCCTTCCCAACCTGACAGCCAGGGACATG
AAGACCTGCCGCTTCCACCCGGACAAGGACCCTTTCTGCCCCATCTTGCGGGTAGGGGAC
GTGGTCAAGTTTGCGGGGCAGGATTTTGCCAAACTGGCGCGCACGGGGGGAGTTCTGGGC
ATTAAGATCGGCTGGGTGTGCGACTTGGACAAGGCCTGGGACCAGTGCATCCCCAAATAC
TCCTTCACCCGGCTCGACAGCGTTTCTGAGAAAAGCAGCGTGTCCCCAGGCTACAACTTC
AGGTTTGCCAAGTACTACAAAATGGAAAATGGCAGTGAGTACCGCACCCTCCTGAAGGCT
TTTGGCATCCGCTTCGACGTGCTGGTATACGGGAATGCTGGCAAGTTCAACATCATCCCC
ACCATCATCAGCTCTGTGGCGGCCTTTACTTCTGTGGGAGTGGGAACTGTTCTCTGTGAC
ATCATCCTGCTCAACTTCCTCAAGGGGGCCGACCAGTACAAAGCCAAGAAGTTTGAGGAG
GTGAATGAGACTACGCTGAAAATCGCGGCTTTGACCAACCCAGTGTACCCCAGCGACCAG
ACCACAGCGGAGAAGCAGTCCACCGATTCGGGGGCCTTCTCCATAGGCCACTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:8534
Chromosome Location11
LocusNot Available
References
  1. Garcia-Guzman M, Soto F, Gomez-Hernandez JM, Lund PE, Stuhmer W: Characterization of recombinant human P2X4 receptor reveals pharmacological differences to the rat homologue. Mol Pharmacol. 1997 Jan;51(1):109-18. 9016352
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334