Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTubulin beta-4B chain
Synonyms
  • TUBB2C
  • Tubulin beta-2 chain
  • Tubulin beta-2C chain
Gene NameTUBB4B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019102|Tubulin beta-4B chain
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
Number of residues445
Molecular Weight49830.72
Theoretical pI4.52
GO Classification
Functions
  • GTP binding
  • GTPase activity
  • MHC class I protein binding
  • unfolded protein binding
  • double-stranded RNA binding
  • structural constituent of cytoskeleton
Processes
  • natural killer cell mediated cytotoxicity
  • organelle organization
  • microtubule-based process
  • 'de novo' posttranslational protein folding
  • cellular protein metabolic process
  • protein folding
  • G2/M transition of mitotic cell cycle
  • mitotic cell cycle
  • movement of cell or subcellular component
Components
  • cytosol
  • extracellular exosome
  • myelin sheath
  • cytoskeleton
  • microtubule
  • extracellular vesicle
  • nucleus
General FunctionUnfolded protein binding
Specific FunctionTubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID37494
UniProtKB IDP68371
UniProtKB Entry NameTBB4B_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0019103|Tubulin beta-4B chain (TUBB4B)
ATGAGGGAAATCGTGCACTTGCAGGCCGGGCAGTGCGGCAACCAAATCGGCGCCAAGTTT
TGGGAGGTGATCAGCGATGAGCACGGCATCGACCCCACGGGCACCTACCACGGGGACAGC
GACCTGCAGCTGGAACGCATCAACGTGTACTACAATGAGGCCACCGGCGGCAAGTACGTG
CCCCGCGCCGTGCTCGTGGATCTGGAGCCCGGCACCATGGACTCCGTGCGCTCGGGGCCC
TTCGGGCAGATCTTCCGGCCGGACAACTTCGTTTTCGGTCAGAGTGGTGCTGGGAACAAC
TGGGCCAAGGGGCACTACACAGAAGGCGCGGAGCTGGTGGACTCGGTGCTGGATGTTGTG
AGAAAGGAGGCTGAGAGCTGTGACTGCCTGCAGGGTTTCCAGCTGACCCACTCCCTGGGT
GGGGGGACTGGGTCTGGGATGGGTACCCTCCTCATCAGCAAGATCCGGGAGGAGTACCCA
GACAGGATCATGAACACGTTTAGTGTGGTGCCTTCGCCCAAAGTGTCAGACACAGTGGTG
GAGCCCTACAACGCCACCCTCTCAGTCCACCAGCTCGTAGAAAACACAGACGAGACCTAC
TGCATTGATAACGAAGCTCTCTACGACATTTGCTTCAGAACCCTAAAGCTGACCACGCCC
ACCTATGGTGACCTGAACCACCTGGTGTCTGCTACCATGAGTGGGGTCACCACCTGCCTG
CGCTTCCCAGGCCAGCTCAATGCTGACCTGCGGAAGCTGGCTGTGAACATGGTCCCGTTT
CCCCGGCTGCACTTCTTCATGCCCGGCTTTGCCCCACTGACCAGCCGGGGCAGCCAGCAG
TACCGGGCGCTGACCGTGCCCGAGCTCACCCAGCAGATGTTTGATGCCAAGAACATGATG
GCTGCCTGCGACCCCCGCCATGGCCGCTACCTGACGGTTGCCGCCGTGTTCAGGGGCCGC
ATGTCCATGAAGGAGGTGGATGAGCAAATGCTTAATGTCCAAAACAAAAACAGCAGCTAT
TTTGTTGAGTGGATCCCCAACAATGTGAAAACGGCTGTCTGTGACATCCCACCTCGGGGG
CTAAAAATGTCCGCCACCTTCATTGGCAACAGCACGGCCATCCAGGAGCTGTTCAAGCGC
ATCTCCGAGCAGTTCACGGCCATGTTCCGGCGCAAGGCCTTCCTGCACTGGTACACGGGC
GAGGGCATGGACGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAATGACCTGGTGTCC
GAGTACCAGCAGTACCAGGATGCCACAGCCGAGGAGGAGGGCGAGTTCGAGGAGGAGGCT
GAGGAGGAGGTGGCCTAG
GenBank Gene IDX02344
GeneCard IDNot Available
GenAtlas IDTUBB2C
HGNC IDHGNC:20771
Chromosome Location9
Locus9q34
References
  1. Lewis SA, Gilmartin ME, Hall JL, Cowan NJ: Three expressed sequences within the human beta-tubulin multigene family each define a distinct isotype. J Mol Biol. 1985 Mar 5;182(1):11-20. 3999141
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. 15164053
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Rogowski K, Juge F, van Dijk J, Wloga D, Strub JM, Levilliers N, Thomas D, Bre MH, Van Dorsselaer A, Gaertig J, Janke C: Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation. Cell. 2009 Jun 12;137(6):1076-87. doi: 10.1016/j.cell.2009.05.020. 19524510
  5. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  6. Leandro-Garcia LJ, Leskela S, Landa I, Montero-Conde C, Lopez-Jimenez E, Leton R, Cascon A, Robledo M, Rodriguez-Antona C: Tumoral and tissue-specific expression of the major human beta-tubulin isotypes. Cytoskeleton (Hoboken). 2010 Apr;67(4):214-23. doi: 10.1002/cm.20436. 20191564
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  8. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712