Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGamma-aminobutyric acid receptor subunit epsilon
Synonyms
  • GABA(A) receptor subunit epsilon
Gene NameGABRE
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006923|Gamma-aminobutyric acid receptor subunit epsilon
MLSKVLPVLLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETE
TGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDI
IFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKD
GKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSW
KLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYVPSSVTTMLSWVSFW
IKTESAPARTSLGITSVLTMTTLGTFSRKNFPRVSYITALDFYIAICFVFCFCALLEFAV
LNFLIYNQTKAHASPKLRHPRINSRAHARTRARSRACARQHQEAFVCQIVTTEGSDGEER
PSCSAQQPPSPGSPEGPRSLCSKLACCEWCKRFKKYFCMVPDCEGSTWQQGRLCIHVYRL
DNYSRVVFPVTFFFFNVLYWLVCLNL
Number of residues506
Molecular Weight57971.175
Theoretical pI8.09
GO Classification
Functions
  • chloride channel activity
  • GABA-A receptor activity
  • inhibitory extracellular ligand-gated ion channel activity
Processes
  • transport
  • chloride transmembrane transport
  • regulation of membrane potential
  • neurological system process
  • response to drug
  • gamma-aminobutyric acid signaling pathway
  • synaptic transmission
Components
  • cell junction
  • integral component of plasma membrane
  • synapse
  • neuron projection
  • postsynaptic membrane
  • chloride channel complex
  • GABA-A receptor complex
General FunctionInhibitory extracellular ligand-gated ion channel activity
Specific FunctionGABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions254-274 281-301 344-364 486-506
GenBank Protein ID1857126
UniProtKB IDP78334
UniProtKB Entry NameGBRE_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0020703|Gamma-aminobutyric acid receptor subunit epsilon (GABRE)
ATGTTGTCCAAAGTTCTTCCAGTCCTCCTAGGCATCTTATTGATCCTCCAGTCGAGGGTC
GAGGGACCTCAGACTGAATCAAAGAATGAAGCCTCTTCCCGTGATGTTGTCTATGGCCCC
CAGCCCCAGCCTCTGGAAAATCAGCTCCTCTCTGAGGAAACAAAGTCAACTGAGACTGAG
ACTGGGAGCAGAGTTGGCAAACTGCCAGAAGCCTCTCGCATCCTGAACACTATCCTGAGT
AATTATGACCACAAACTGCGCCCTGGCATTGGAGAGAAGCCCACTGTGGTCACTGTTGAG
ATCTCCGTCAACAGCCTTGGTCCTCTCTCTATCCTAGACATGGAATACACCATTGACATC
ATCTTCTCCCAGACCTGGTACGACGAACGCCTCTGTTACAACGACACCTTTGAGTCTCTT
GTTCTGAATGGCAATGTGGTGAGCCAGCTATGGATCCCGGACACCTTTTTTAGGAATTCT
AAGAGGACCCACGAGCATGAGATCACCATGCCCAACCAGATGGTCCGCATCTACAAGGAT
GGCAAGGTGTTGTACACAATTAGGATGACCATTGATGCCGGATGCTCACTCCACATGCTC
AGATTTCCAATGGATTCTCACTCTTGCCCTCTATCTTTCTCTAGCTTTTCCTATCCTGAG
AATGAGATGATCTACAAGTGGGAAAATTTCAAGCTTGAAATCAATGAGAAGAACTCCTGG
AAGCTCTTCCAGTTTGATTTTACAGGAGTGAGCAACAAAACTGAAATAATCACAACCCCA
GTTGGTGACTTCATGGTCATGACGATTTTCTTCAATGTGAGCAGGCGGTTTGGCTATGTT
GCCTTTCAAAACTATGTCCCTTCTTCCGTGACCACGATGCTCTCCTGGGTTTCCTTTTGG
ATCAAGACAGAGTCTGCTCCAGCCCGGACCTCTCTAGGGATCACCTCTGTTCTGACCATG
ACCACGTTGGGCACCTTTTCTCGTAAGAATTTCCCGCGTGTCTCCTATATCACAGCCTTG
GATTTCTATATCGCCATCTGCTTCGTCTTCTGCTTCTGCGCTCTGTTGGAGTTTGCTGTG
CTCAACTTCCTGATCTACAACCAGACAAAAGCCCATGCTTCTCCTAAACTCCGCCATCCT
CGTATCAATAGCCGTGCCCATGCCCGTACCCGTGCACGTTCCCGAGCCTGTGCCCGCCAA
CATCAGGAAGCTTTTGTGTGCCAGATTGTCACCACTGAGGGAAGTGATGGAGAGGAGCGC
CCGTCTTGCTCAGCCCAGCAGCCCCCTAGCCCAGGTAGCCCTGAGGGTCCCCGCAGCCTC
TGCTCCAAGCTGGCCTGCTGTGAGTGGTGCAAGCGTTTTAAGAAGTACTTCTGCATGGTC
CCCGATTGTGAGGGCAGTACCTGGCAGCAGGGCCGCCTCTGCATCCATGTCTACCGCCTG
GATAACTACTCGAGAGTTGTTTTCCCAGTGACTTTCTTCTTCTTCAATGTGCTCTACTGG
CTTGTTTGCCTTAACTTGTAG
GenBank Gene IDU66661
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4085
Chromosome LocationX
LocusNot Available
References
  1. Davies PA, Hanna MC, Hales TG, Kirkness EF: Insensitivity to anaesthetic agents conferred by a class of GABA(A) receptor subunit. Nature. 1997 Feb 27;385(6619):820-3. 9039914
  2. Wilke K, Gaul R, Klauck SM, Poustka A: A gene in human chromosome band Xq28 (GABRE) defines a putative new subunit class of the GABAA neurotransmitter receptor. Genomics. 1997 Oct 1;45(1):1-10. 9339354
  3. Garret M, Bascles L, Boue-Grabot E, Sartor P, Charron G, Bloch B, Margolskee RF: An mRNA encoding a putative GABA-gated chloride channel is expressed in the human cardiac conduction system. J Neurochem. 1997 Apr;68(4):1382-9. 9084408
  4. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. 15772651
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334