You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameDNA-directed RNA polymerase subunit beta'
Synonyms
  • 2.7.7.6
  • RNA polymerase subunit beta'
  • RNAP subunit beta'
  • Transcriptase subunit beta'
Gene NamerpoC
OrganismMycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Amino acid sequence
>lcl|BSEQ0051304|DNA-directed RNA polymerase subunit beta'
MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWEC
YCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDL
APKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKAVEDQRDGELEARAQKLEAD
LAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVA
AFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDL
GAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKSLSDLLKGKQGRFRQNLLGK
RVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQ
MAVHLPLSAEAQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQ
PASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQLRPPVEIEAELFGHSGWQPGD
AWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKE
ATDEVGQALREHYPDDNPIITIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSF
REGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCQTERGIVVE
LAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGV
GEDITGGLPRVQELFEARVPRGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKI
SKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHEVLRVQGPREVQIHLVREVQE
VYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPA
GTGINRYRNIAVQPTEEARAAAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
Number of residues1316
Molecular Weight146768.085
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
  • DNA-directed 5'-3' RNA polymerase activity
Processes
  • growth
  • transcription, DNA-templated
Components
  • plasma membrane
  • cell wall
  • DNA-directed RNA polymerase complex
General FunctionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Specific FunctionDna binding
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP9WGY7
UniProtKB Entry NameRPOC_MYCTU
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0051305|DNA-directed RNA polymerase subunit beta' (rpoC)
GTGCTCGACGTCAACTTCTTCGATGAACTCCGCATCGGTCTTGCTACCGCGGAGGACATC
AGGCAATGGTCCTATGGCGAGGTCAAAAAGCCGGAGACGATCAACTACCGCACGCTTAAG
CCGGAGAAGGACGGCCTGTTCTGCGAGAAGATCTTCGGGCCGACTCGCGACTGGGAATGC
TACTGCGGCAAGTACAAGCGGGTGCGCTTCAAGGGCATCATCTGCGAGCGCTGCGGCGTC
GAGGTGACCCGCGCCAAGGTGCGTCGTGAGCGGATGGGCCACATCGAGCTTGCCGCGCCC
GTCACCCACATCTGGTACTTCAAGGGTGTGCCCTCGCGGCTGGGGTATCTGCTGGACCTG
GCCCCGAAGGACCTGGAGAAGATCATCTACTTCGCTGCCTACGTGATCACCTCGGTCGAC
GAGGAGATGCGCCACAATGAGCTCTCCACGCTCGAGGCCGAAATGGCGGTGGAGCGCAAG
GCCGTCGAAGACCAGCGCGACGGCGAACTAGAGGCCCGGGCGCAAAAGCTGGAGGCCGAC
CTGGCCGAGCTGGAGGCCGAGGGCGCCAAGGCCGATGCGCGGCGCAAGGTTCGCGACGGC
GGCGAGCGCGAGATGCGCCAGATCCGTGACCGCGCGCAGCGTGAGCTGGACCGGTTGGAG
GACATCTGGAGCACTTTCACCAAGCTGGCGCCCAAGCAGCTGATCGTCGACGAAAACCTC
TACCGCGAACTCGTCGACCGCTACGGCGAGTACTTCACCGGTGCCATGGGCGCGGAGTCG
ATCCAGAAGCTGATCGAGAACTTCGACATCGACGCCGAAGCCGAGTCGCTGCGGGATGTC
ATCCGAAACGGCAAGGGGCAGAAGAAGCTTCGCGCCCTCAAGCGGCTGAAGGTGGTTGCG
GCGTTCCAACAGTCGGGCAACTCGCCGATGGGCATGGTGCTCGACGCCGTCCCGGTGATC
CCGCCGGAGCTGCGCCCGATGGTGCAGCTCGACGGCGGCCGGTTCGCCACGTCCGACTTG
AACGACCTGTACCGCAGGGTGATCAACCGCAACAACCGGCTGAAAAGGCTGATCGATCTG
GGTGCGCCGGAAATCATCGTCAACAACGAGAAGCGGATGCTGCAGGAATCCGTGGACGCG
CTGTTCGACAATGGCCGCCGCGGCCGGCCCGTCACCGGGCCGGGCAACCGTCCGCTCAAG
TCGCTTTCCGATCTGCTCAAGGGCAAGCAGGGCCGGTTCCGGCAGAACCTGCTCGGCAAG
CGTGTCGACTACTCGGGCCGGTCGGTCATCGTGGTCGGCCCGCAGCTCAAGCTGCACCAG
TGCGGTCTGCCCAAGCTGATGGCGCTGGAGCTGTTCAAGCCGTTCGTGATGAAGCGGCTG
GTGGACCTCAACCATGCGCAGAACATCAAGAGCGCCAAGCGCATGGTGGAGCGCCAGCGC
CCCCAAGTGTGGGATGTGCTCGAAGAGGTCATCGCCGAGCACCCGGTGTTGCTGAACCGC
GCACCCACCCTGCACCGGTTGGGTATCCAGGCCTTCGAGCCAATGCTGGTGGAAGGCAAG
GCCATTCAGCTGCACCCGTTGGTGTGTGAGGCGTTCAATGCCGACTTCGACGGTGACCAG
ATGGCCGTGCACCTGCCTTTGAGCGCCGAAGCGCAGGCCGAGGCTCGCATTTTGATGTTG
TCCTCCAACAACATCCTGTCGCCGGCATCTGGGCGTCCGTTGGCCATGCCGCGGCTGGAC
ATGGTGACCGGGCTGTACTACCTGACCACCGAGGTCCCCGGGGACACCGGCGAATACCAG
CCGGCCAGCGGGGATCACCCGGAGACTGGTGTCTACTCTTCGCCGGCCGAAGCGATCATG
GCGGCCGACCGCGGTGTCTTGAGCGTGCGGGCCAAGATCAAGGTGCGGCTGACCCAGCTG
CGGCCGCCGGTCGAGATCGAGGCCGAGCTATTCGGCCACAGCGGCTGGCAGCCGGGCGAT
GCGTGGATGGCCGAGACCACGCTGGGCCGGGTGATGTTCAACGAGCTGCTGCCGCTGGGT
TATCCGTTCGTCAACAAGCAGATGCACAAGAAGGTGCAGGCCGCCATCATCAACGACCTG
GCCGAGCGTTACCCGATGATCGTGGTCGCCCAGACCGTCGACAAGCTCAAGGACGCCGGC
TTCTACTGGGCCACCCGCAGCGGCGTGACGGTGTCGATGGCCGACGTGCTGGTGCCGCCG
CGCAAGAAGGAGATCCTCGACCACTACGAGGAGCGCGCGGACAAGGTCGAAAAGCAGTTC
CAGCGTGGCGCTTTGAACCACGACGAGCGCAACGAGGCGCTGGTGGAGATTTGGAAGGAA
GCCACCGACGAGGTCGGTCAGGCGTTGCGGGAGCACTACCCCGACGACAACCCGATCATC
ACCATCGTCGACTCCGGCGCCACCGGCAACTTCACCCAGACTCGAACGCTGGCCGGTATG
AAGGGCCTGGTGACCAACCCGAAGGGTGAGTTCATCCCGCGTCCGGTCAAGTCCTCCTTC
CGTGAGGGCCTGACCGTGCTGGAGTACTTCATCAACACCCACGGCGCTCGAAAGGGCTTG
GCGGACACCGCGTTGCGCACCGCCGACTCCGGCTACCTGACCCGACGTCTGGTGGACGTG
TCCCAGGACGTGATCGTGCGCGAGCACGACTGCCAGACCGAGCGCGGCATCGTCGTCGAG
CTGGCCGAGCGTGCACCCGACGGCACGCTGATCCGCGACCCGTACATCGAAACCTCGGCC
TACGCGCGGACCCTGGGCACCGACGCGGTCGACGAGGCCGGCAACGTCATCGTCGAGCGT
GGTCAAGACCTGGGCGATCCGGAGATTGACGCTCTGTTGGCTGCTGGTATTACCCAGGTC
AAGGTGCGTTCGGTGCTGACGTGTGCCACCAGCACCGGCGTGTGCGCGACCTGCTACGGG
CGTTCCATGGCCACCGGCAAGCTGGTCGACATCGGTGAAGCCGTCGGCATCGTGGCCGCC
CAGTCCATCGGCGAACCCGGCACCCAGCTGACCATGCGCACCTTCCACCAGGGTGGCGTC
GGTGAGGACATCACCGGTGGTCTGCCCCGGGTGCAGGAGCTGTTCGAGGCCCGGGTACCG
CGTGGCAAGGCGCCGATCGCCGACGTCACCGGCCGGGTTCGGCTCGAGGACGGCGAGCGG
TTCTACAAGATCACCATCGTTCCTGACGACGGCGGTGAGGAAGTGGTCTACGACAAGATC
TCCAAGCGGCAGCGGCTGCGGGTGTTCAAGCACGAAGACGGTTCCGAACGGGTGCTCTCC
GATGGCGACCACGTCGAGGTGGGCCAGCAGCTGATGGAAGGCTCGGCCGACCCGCATGAG
GTGCTGCGGGTGCAGGGCCCCCGCGAGGTGCAGATACACCTGGTTCGCGAGGTCCAGGAG
GTCTACCGCGCCCAAGGTGTGTCGATCCACGACAAGCACATCGAGGTGATCGTTCGCCAG
ATGCTGCGCCGGGTGACCATCATCGACTCGGGCTCGACGGAGTTTTTGCCTGGCTCGCTG
ATCGACCGCGCGGAGTTCGAGGCAGAGAACCGCCGAGTGGTGGCCGAGGGCGGTGAGCCC
GCGGCCGGCCGTCCGGTGCTGATGGGCATCACGAAGGCGTCGCTGGCCACCGACTCGTGG
CTGTCGGCGGCGTCGTTCCAGGAGACCACTCGCGTGCTGACCGATGCGGCGATCAACTGC
CGCAGCGATAAGCTCAACGGTCTGAAGGAAAACGTGATCATCGGCAAGCTGATCCCGGCC
GGTACCGGTATCAACCGCTACCGCAACATCGCGGTGCAGCCCACCGAGGAGGCCCGCGCT
GCGGCGTACACCATCCCGTCGTATGAGGATCAGTACTACAGCCCGGACTTCGGTGCGGCC
ACCGGTGCTGCCGTCCCGCTGGACGACTACGGCTACAGCGACTACCGCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. 9634230
  2. Miller LP, Crawford JT, Shinnick TM: The rpoB gene of Mycobacterium tuberculosis. Antimicrob Agents Chemother. 1994 Apr;38(4):805-11. 8031050
  3. Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K: Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol Microbiol. 2002 Feb;43(3):717-31. 11929527
  4. Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. 21969609
  5. Hu Y, Morichaud Z, Chen S, Leonetti JP, Brodolin K: Mycobacterium tuberculosis RbpA protein is a new type of transcriptional activator that stabilizes the sigma A-containing RNA polymerase holoenzyme. Nucleic Acids Res. 2012 Aug;40(14):6547-57. doi: 10.1093/nar/gks346. Epub 2012 May 8. 22570422