Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSodium channel protein type 7 subunit alpha
Synonyms
  • Putative voltage-gated sodium channel subunit alpha Nax
  • SCN6A
  • Sodium channel protein cardiac and skeletal muscle subunit alpha
  • Sodium channel protein type VII subunit alpha
Gene NameSCN7A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017554|Sodium channel protein type 7 subunit alpha
MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEEDLKPTPDLEVGKKLPFIYGNLSQG
MVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRRTTIKVLVHPFF
QLFILISVLIDCVFMSLTNLPKWRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPW
NWLDFSVTVFEVIIRYSPLDFIPTLQTARTLRILKIIPLNQGLKSLVGVLIHCLKQLIGV
IILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEG
ERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYH
QILYASGKVYMIFFVVVSFLFSFYMASLFLGILAMAYEEEKQRVGEISKKIEPKFQQTGK
ELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFAK
TFLIWNCSPCWLKLKEFVHRIIMAPFTDLFLIICIILNVCFLTLEHYPMSKQTNTLLNIG
NLVFIGIFTAEMIFKIIAMHPYGYFQVGWNIFDSMIVFHGLIELCLANVAGMALLRLFRM
LRIFKLGKYWPTFQILMWSLSNSWVALKDLVLLLFTFIFFSAAFGMKLFGKNYEEFVCHI
DKDCQLPRWHMHDFFHSFLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNLLV
LYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKTQNVPKDTMDH
VNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIAS
GESDIENLDNKEIQSKSGDGGSKEKIKQSSSSECSTVDIAISEEEEMFYGGERSKHLKNG
CRRGSSLGQISGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYMDQ
RKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTR
EELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLVCLMIWLIFSIMGVDLF
AGRFYECIDPTSGERFPSSEVMNKSRCESLLFNESMLWENAKMNFDNVGNGFLSLLQVAT
FNGWITIMNSAIDSVAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLITVIIDNFNKHK
IKLGGSNIFITVKQRKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQAFNVIVMVL
ICFQAIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKLIAFRCFYFTIAWNIFDFM
VVIFSITGLCLPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPKVFHNLMLPLMLSLPAL
LNIILLIFLVMFIYAVFGMYNFAYVKKEAGINDVSNFETFGNSMLCLFQVAIFAGWDGML
DAIFNSKWSDCDPDKINPGTQVRGDCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLN
IASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLI
ALDLPMAVGDRIHCLDILLAFTKRVMGQDVRMEKVVSEIESGFLLANPFKITCEPITTTL
KRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATKEGAYFDKAKEKSPIQS
QI
Number of residues1682
Molecular Weight193491.605
Theoretical pINot Available
GO Classification
Functions
  • voltage-gated sodium channel activity
Processes
  • sodium ion transmembrane transport
  • sodium ion homeostasis
  • membrane depolarization during action potential
  • neuronal action potential
  • muscle contraction
  • sodium ion transport
Components
  • plasma membrane
  • glial cell projection
  • voltage-gated sodium channel complex
General FunctionVoltage-gated sodium channel activity
Specific FunctionMediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
Pfam Domain Function
Transmembrane Regions114-140 143-168 180-202 204-223 240-264 369-395 501-524 536-559 567-590 593-609 630-650 705-728 930-958 966-991 997-1019 1022-1040 1060-1080 1167-1193 1248-1270 1281-1305 1312-1335 1345-1369 1379-1405 1470-1496
GenBank Protein IDNot Available
UniProtKB IDQ01118
UniProtKB Entry NameSCN7A_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0017555|Sodium channel protein type 7 subunit alpha (SCN7A)
ATGTTGGCTTCACCAGAACCTAAGGGCCTTGTTCCCTTCACTAAAGAGTCTTTTGAACTT
ATAAAACAGCATATTGCTAAAACACATAATGAAGACCATGAAGAAGAAGACTTAAAGCCA
ACTCCTGATTTGGAAGTTGGCAAAAAGCTTCCATTTATTTATGGAAACCTTTCTCAAGGA
ATGGTGTCAGAGCCCTTGGAAGATGTGGACCCATATTACTACAAGAAAAAAAATACTTTC
ATAGTATTAAATAAAAATAGAACAATCTTCAGATTCAATGCGGCTTCCATCTTGTGTACA
TTGTCTCCTTTCAATTGTATTAGAAGAACAACTATCAAGGTTTTGGTACATCCCTTTTTC
CAACTGTTTATTCTAATTAGTGTCCTGATTGATTGCGTATTCATGTCCCTGACTAATTTG
CCAAAATGGAGACCAGTATTAGAGAATACTTTGCTTGGAATTTACACATTTGAAATACTT
GTAAAACTCTTTGCAAGAGGTGTCTGGGCAGGATCATTTTCCTTCCTCGGTGATCCATGG
AACTGGCTCGATTTCAGCGTAACTGTGTTTGAGGTTATTATAAGATACTCACCTCTGGAC
TTCATTCCAACGCTTCAAACTGCAAGAACTTTGAGAATTTTAAAAATTATTCCTTTAAAT
CAAGGTCTGAAATCCCTTGTAGGGGTCCTGATCCACTGCTTGAAGCAGCTTATTGGTGTC
ATTATCCTAACTCTGTTTTTTCTGAGCATATTTTCTCTAATTGGGATGGGGCTCTTCATG
GGCAACTTGAAACATAAATGTTTTCGATGGCCCCAAGAGAATGAAAATGAAACCCTGCAC
AACAGAACTGGAAACCCATATTATATTCGAGAAACAGAAAACTTTTATTATTTGGAAGGA
GAAAGATATGCTCTCCTTTGTGGCAACAGGACAGATGCTGGTCAGTGTCCTGAAGGATAT
GTGTGTGTAAAAGCTGGCATAAATCCTGATCAAGGCTTCACAAATTTTGACAGTTTTGGC
TGGGCCTTATTTGCCCTATTTCGGTTAATGGCTCAGGATTACCCTGAAGTACTTTATCAC
CAGATACTTTATGCTTCTGGGAAGGTCTACATGATATTTTTTGTGGTGGTAAGTTTTTTG
TTTTCCTTTTATATGGCAAGTTTGTTCTTAGGCATACTTGCCATGGCCTATGAAGAAGAA
AAGCAGAGAGTTGGTGAAATATCTAAGAAGATTGAACCAAAATTTCAACAGACTGGAAAA
GAACTTCAAGAAGGAAATGAAACAGATGAGGCCAAGACCATACAAATAGAAATGAAGAAA
AGGTCACCAATTTCCACAGACACATCATTGGATGTGTTGGAAGATGCTACTCTCAGACAT
AAGGAAGAACTTGAAAAATCCAAGAAGATATGCCCATTATACTGGTATAAGTTTGCTAAA
ACTTTCTTGATCTGGAATTGTTCTCCCTGTTGGTTAAAATTGAAAGAGTTTGTCCATAGG
ATTATAATGGCACCATTTACTGATCTTTTCCTTATCATATGCATAATTTTAAACGTATGT
TTTCTGACCTTGGAGCATTATCCAATGAGTAAACAAACTAACACTCTTCTCAACATTGGA
AACCTGGTTTTCATTGGAATTTTCACAGCAGAAATGATTTTTAAAATAATTGCAATGCAT
CCATATGGGTATTTCCAAGTAGGTTGGAACATTTTTGATAGCATGATAGTGTTCCATGGT
TTAATAGAACTTTGTCTAGCAAATGTTGCAGGAATGGCTCTTCTTCGATTATTCAGGATG
TTAAGAATTTTCAAGTTGGGAAAGTATTGGCCAACATTCCAGATTTTGATGTGGTCTCTT
AGTAACTCATGGGTGGCCCTGAAAGACTTGGTCCTGTTGTTGTTCACATTCATCTTCTTT
TCTGCTGCATTCGGCATGAAGCTGTTTGGTAAGAATTATGAAGAATTTGTCTGCCACATA
GACAAAGACTGTCAACTCCCACGCTGGCACATGCATGACTTTTTCCACTCCTTCCTGAAT
GTGTTCCGAATTCTCTGTGGAGAGTGGGTAGAGACCTTGTGGGACTGTATGGAGGTTGCA
GGCCAATCCTGGTGTATTCCTTTTTACCTGATGGTCATTTTAATTGGAAATTTACTGGTA
CTTTACCTGTTTCTGGCATTGGTGAGCTCATTTAGTTCATGCAAGGATGTAACAGCTGAA
GAGAATAATGAAGCAAAAAATCTCCAGCTTGCAGTGGCAAGAATTAAAAAAGGAATAAAC
TATGTGCTTCTTAAAATACTATGCAAAACACAAAATGTCCCAAAGGACACAATGGACCAT
GTAAATGAGGTATATGTTAAAGAAGATATTTCTGACCATACCCTTTCTGAATTGAGCAAC
ACCCAAGATTTTCTCAAAGATAAGGAAAAAAGCAGTGGCACAGAGAAAAACGCTACTGAA
AATGAGAGCCAATCACTTATCCCCAGTCCTAGTGTCTCAGAAACTGTACCAATTGCTTCA
GGAGAATCTGATATAGAAAATCTGGATAATAAGGAGATTCAGAGTAAGTCTGGTGATGGA
GGCAGCAAAGAGAAAATAAAGCAATCTAGCTCATCTGAATGCAGTACTGTTGATATTGCT
ATCTCTGAAGAAGAAGAAATGTTCTATGGAGGTGAAAGATCAAAGCATCTGAAAAATGGT
TGCAGACGCGGATCTTCACTTGGTCAAATCAGTGGAGCATCCAAGAAAGGAAAAATCTGG
CAGAACATCAGGAAAACCTGCTGCAAGATTGTAGAGAACAATTGGTTTAAGTGTTTTATT
GGGCTTGTTACTCTGCTCAGCACTGGCACTCTGGCTTTTGAAGATATATATATGGATCAG
AGAAAGACAATTAAAATTTTATTAGAATATGCTGACATGATCTTTACTTATATCTTCATT
CTGGAAATGCTTCTAAAATGGATGGCATATGGTTTTAAGGCCTATTTCTCTAATGGCTGG
TACAGGCTGGACTTCGTGGTTGTTATTGTGTTTTGTCTTAGCTTAATAGGCAAAACTCGG
GAAGAACTAAAACCTCTTATTTCCATGAAATTCCTTCGGCCCCTCAGAGTTCTATCTCAA
TTTGAAAGAATGAAGGTGGTTGTGAGAGCTTTGATCAAAACAACCTTACCCACTTTGAAT
GTGTTTCTTGTCTGCCTGATGATCTGGCTGATTTTTAGTATCATGGGAGTAGACTTATTT
GCTGGCAGATTCTATGAATGCATTGACCCAACAAGTGGAGAAAGGTTTCCTTCATCTGAA
GTCATGAATAAGAGTCGGTGTGAAAGCCTTCTGTTTAACGAATCCATGCTATGGGAAAAT
GCAAAAATGAACTTTGATAATGTTGGAAATGGTTTCCTTTCTCTGCTTCAAGTAGCAACA
TTTAATGGATGGATCACTATTATGAATTCAGCAATTGATTCTGTTGCTGTTAATATACAG
CCTCATTTTGAAGTCAACATCTACATGTATTGTTACTTTATCAACTTTATTATATTTGGA
GTATTTCTCCCTCTGAGTATGCTGATTACTGTTATTATTGATAATTTCAACAAGCATAAA
ATAAAGCTGGGAGGCTCAAATATCTTTATAACGGTTAAACAGAGAAAACAGTACCGCAGG
CTGAAGAAGCTAATGTATGAGGATTCTCAAAGACCAGTACCTCGCCCATTAAACAAGCTC
CAAGGATTCATCTTTGATGTGGTAACAAGCCAAGCTTTTAATGTCATTGTTATGGTTCTT
ATATGTTTCCAAGCAATAGCCATGATGATAGACACTGATGTTCAGAGTCTACAAATGTCC
ATTGCTCTCTACTGGATTAACTCAATTTTTGTTATGCTATATACTATGGAATGTATACTG
AAGCTCATCGCTTTCCGTTGTTTTTATTTCACCATTGCGTGGAACATTTTTGATTTTATG
GTGGTTATTTTCTCCATCACAGGACTATGTCTGCCTATGACAGTAGGATCCTACCTTGTG
CCTCCTTCACTTGTGCAACTGATACTTCTCTCACGGATCATTCACATGCTGCGTCTTGGA
AAAGGACCAAAGGTGTTTCATAATCTGATGCTTCCTTTGATGCTGTCCCTCCCAGCATTA
TTGAACATCATTCTTCTCATCTTCCTGGTCATGTTCATCTATGCCGTATTTGGAATGTAT
AATTTTGCCTATGTTAAAAAAGAAGCTGGAATTAATGATGTGTCTAATTTTGAAACCTTT
GGCAACAGTATGCTCTGTCTTTTTCAAGTTGCAATATTTGCTGGTTGGGATGGGATGCTT
GATGCAATTTTCAACAGTAAATGGTCTGACTGTGATCCTGATAAAATTAACCCTGGGACT
CAAGTTAGAGGAGATTGTGGGAACCCCTCTGTTGGGATTTTTTATTTTGTCAGTTATATC
CTCATATCATGGCTGATCATTGTAAATATGTACATTGTTGTTGTCATGGAGTTTTTAAAT
ATTGCTTCTAAGAAGAAAAACAAGACCTTGAGTGAAGATGATTTTAGGAAATTCTTTCAG
GTATGGAAAAGGTTTGATCCTGATAGGACCCAGTACATAGACTCTAGCAAGCTTTCAGAT
TTTGCAGCTGCTCTTGATCCTCCTCTTTTCATGGCAAAACCAAACAAGGGCCAGCTCATT
GCTTTGGACCTCCCCATGGCTGTTGGGGACAGAATTCATTGCCTCGATATCTTACTTGCT
TTTACAAAGAGAGTTATGGGTCAAGATGTGAGGATGGAGAAAGTTGTTTCAGAAATAGAA
TCAGGGTTTTTGTTAGCCAACCCTTTTAAGATCACATGTGAGCCAATTACGACTACTTTG
AAACGAAAACAAGAGGCAGTTTCAGCAACCATCATTCAACGTGCTTATAAAAATTACCGC
TTGAGGCGAAATGACAAAAATACATCAGATATTCATATGATAGATGGTGACAGAGATGTT
CATGCTACTAAAGAAGGTGCCTATTTTGACAAAGCTAAGGAAAAGTCACCTATTCAAAGC
CAGATCTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:10594
Chromosome Location2
LocusNot Available
References
  1. George AL Jr, Knittle TJ, Tamkun MM: Molecular cloning of an atypical voltage-gated sodium channel expressed in human heart and uterus: evidence for a distinct gene family. Proc Natl Acad Sci U S A. 1992 Jun 1;89(11):4893-7. 1317577
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  3. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569