You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHistone H1.1
Synonyms
  • H1F1
  • Histone H1a
Gene NameHIST1H1A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013485|Histone H1.1
MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGV
SLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETK
PGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKV
AKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
Number of residues215
Molecular Weight21841.89
Theoretical pINot Available
GO Classification
Functions
  • chromatin DNA binding
Processes
  • nucleosome assembly
  • spermatogenesis
Components
  • nucleosome
  • nuclear chromatin
  • nuclear euchromatin
General FunctionChromatin dna binding
Specific FunctionHistone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts also as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ02539
UniProtKB Entry NameH11_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013486|Histone H1.1 (HIST1H1A)
ATGTCTGAAACAGTGCCTCCCGCCCCCGCCGCTTCTGCTGCTCCTGAGAAACCTTTAGCT
GGCAAGAAGGCAAAGAAACCTGCTAAGGCTGCAGCAGCCTCCAAGAAAAAACCCGCTGGC
CCTTCCGTGTCAGAGCTGATCGTGCAGGCTGCTTCCTCCTCTAAGGAGCGTGGTGGTGTG
TCGTTGGCAGCTCTTAAAAAGGCGCTGGCGGCCGCAGGCTACGACGTGGAGAAGAACAAC
AGCCGCATTAAGCTGGGCATTAAGAGCCTGGTAAGCAAGGGAACGTTGGTGCAGACAAAG
GGTACCGGAGCCTCGGGTTCCTTCAAGCTCAACAAGAAGGCGTCCTCCGTGGAAACCAAG
CCCGGCGCCTCAAAGGTGGCTACAAAAACTAAGGCAACGGGTGCATCTAAAAAGCTCAAA
AAGGCCACGGGGGCTAGCAAAAAGAGCGTCAAGACTCCGAAAAAGGCTAAAAAGCCTGCG
GCAACAAGGAAATCCTCCAAGAATCCAAAAAAACCCAAAACTGTAAAGCCCAAGAAAGTA
GCTAAAAGCCCTGCTAAAGCTAAGGCTGTAAAACCCAAGGCGGCCAAGGCTAGGGTGACG
AAGCCAAAGACTGCCAAACCCAAGAAAGCGGCACCCAAGAAAAAGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4715
Chromosome Location6
LocusNot Available
References
  1. Eick S, Nicolai M, Mumberg D, Doenecke D: Human H1 histones: conserved and varied sequence elements in two H1 subtype genes. Eur J Cell Biol. 1989 Jun;49(1):110-5. 2759094
  2. Marzluff WF, Gongidi P, Woods KR, Jin J, Maltais LJ: The human and mouse replication-dependent histone genes. Genomics. 2002 Nov;80(5):487-98. 12408966
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. 14574404
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Parseghian MH, Henschen AH, Krieglstein KG, Hamkalo BA: A proposal for a coherent mammalian histone H1 nomenclature correlated with amino acid sequences. Protein Sci. 1994 Apr;3(4):575-87. 8003976
  6. Hendzel MJ, Lever MA, Crawford E, Th'ng JP: The C-terminal domain is the primary determinant of histone H1 binding to chromatin in vivo. J Biol Chem. 2004 May 7;279(19):20028-34. Epub 2004 Feb 25. 14985337
  7. Th'ng JP, Sung R, Ye M, Hendzel MJ: H1 family histones in the nucleus. Control of binding and localization by the C-terminal domain. J Biol Chem. 2005 Jul 29;280(30):27809-14. Epub 2005 May 23. 15911621
  8. Ninios YP, Sekeri-Pataryas KE, Sourlingas TG: Histone H1 subtype preferences of DFF40 and possible nuclear localization of DFF40/45 in normal and trichostatin A-treated NB4 leukemic cells. Apoptosis. 2010 Feb;15(2):128-38. doi: 10.1007/s10495-009-0418-7. 19882353
  9. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460