You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGrowth hormone-releasing hormone receptor
Synonyms
  • GHRH receptor
  • GRF receptor
  • GRFR
  • Growth hormone-releasing factor receptor
Gene NameGHRHR
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016157|Growth hormone-releasing hormone receptor
MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWD
GLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLA
EEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVF
LKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRR
AFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLF
LNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPL
ELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLT
SMC
Number of residues423
Molecular Weight47401.53
Theoretical pI6.73
GO Classification
Functions
  • growth factor binding
  • peptide hormone binding
  • growth hormone-releasing hormone receptor activity
  • G-protein coupled receptor activity
Processes
  • lactation
  • cell maturation
  • hormone metabolic process
  • positive regulation of multicellular organism growth
  • cAMP-mediated signaling
  • activation of adenylate cyclase activity
  • positive regulation of insulin-like growth factor receptor signaling pathway
  • cell surface receptor signaling pathway
  • multicellular organismal reproductive process
  • positive regulation of cell proliferation
  • growth hormone secretion
  • response to estrogen
  • determination of adult lifespan
  • response to glucocorticoid
  • water homeostasis
  • cellular response to insulin stimulus
  • positive regulation of growth hormone secretion
  • positive regulation of cAMP biosynthetic process
  • regulation of intracellular steroid hormone receptor signaling pathway
  • response to insulin
  • regulation of protein metabolic process
  • adenylate cyclase-activating G-protein coupled receptor signaling pathway
  • somatotropin secreting cell development
Components
  • nuclear inner membrane
  • nuclear matrix
  • cell surface
  • integral component of membrane
  • secretory granule
  • nuclear outer membrane
  • cytoplasm
  • plasma membrane
General FunctionPeptide hormone binding
Specific FunctionReceptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
Pfam Domain Function
Transmembrane Regions133-152 163-181 205-227 241-262 281-304 330-348 362-381
GenBank Protein ID183173
UniProtKB IDQ02643
UniProtKB Entry NameGHRHR_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0016158|Growth hormone-releasing hormone receptor (GHRHR)
ATGGACCGCCGGATGTGGGGGGCCCACGTCTTCTGCGTGTTGAGCCCGTTACCGACCGTA
TTGGGCCACATGCACCCAGAATGTGACTTCATCACCCAGCTGAGAGAGGATGAGAGTGCC
TGTCTACAAGCAGCAGAGGAGATGCCCAACACCACCCTGGGCTGCCCTGCGACCTGGGAT
GGGCTGCTGTGCTGGCCAACGGCAGGCTCTGGCGAGTGGGTCACCCTCCCCTGCCCGGAT
TTCTTCTCTCACTTCAGCTCAGAGTCAGGGGCTGTGAAACGGGATTGTACTATCACTGGC
TGGTCTGAGCCCTTTCCACCTTACCCTGTGGCCTGCCCTGTGCCTCTGGAGCTGCTGGCT
GAGGAGGAATCTTACTTCTCCACAGTGAAGATTATCTACACCGTGGGCCATAGCATCTCT
ATTGTAGCCCTCTTCGTGGCCATCACCATCCTGGTTGCTCTCAGGAGGCTCCACTGCCCC
CGGAACTACGTCCACACCCAGCTGTTCACCACTTTTATCCTCAAGGCGGGAGCTGTGTTC
CTGAAGGATGCTGCCCTTTTCCACAGCGACGACACTGACCACTGCAGCTTCTCCACTGTT
CTATGCAAGGTCTCTGTGGCCGCCTCCCATTTCGCCACCATGACCAACTTCAGCTGGCTG
TTGGCAGAAGCCGTCTACCTGAACTGCCTCCTGGCCTCCACCTCCCCCAGCTCAAGGAGA
GCCTTCTGGTGGCTGGTTCTCGCTGGCTGGGGGCTGCCCGTGCTCTTCACTGGCACGTGG
GTGAGCTGCAAACTGGCCTTCGAGGACATCGCGTGCTGGGACCTGGACGACACCTCCCCC
TACTGGTGGATCATCAAAGGGCCCATTGTCCTCTCGGTCGGGGTGAACTTTGGGCTTTTT
CTCAATATTATCCGCATCCTGGTGAGGAAACTGGAGCCAGCTCAGGGCAGCCTCCATACC
CAGTCTCAGTATTGGCGTCTCTCCAAGTCGACACTTTTCCTGATCCCACTCTTTGGAATT
CACTACATCATCTTCAACTTCCTGCCAGACAATGCTGGCCTGGGCATCCGCCTCCCCCTG
GAGCTGGGACTGGGTTCCTTCCAGGGCTTCATTGTTGCCATCCTCTACTGCTTCCTCAAC
CAAGAGGTGAGGACTGAGATCTCACGGAAGTGGCATGGCCATGACCCTGAGCTTCTGCCA
GCCTGGAGGACCCGTGCTAAGTGGACCACGCCTTCCCGCTCGGCGGCAAAGGTGCTGACA
TCTATGTGCTAG
GenBank Gene IDL01406
GeneCard IDNot Available
GenAtlas IDGHRHR
HGNC IDHGNC:4266
Chromosome Location7
Locus7p14
References
  1. Mayo KE: Molecular cloning and expression of a pituitary-specific receptor for growth hormone-releasing hormone. Mol Endocrinol. 1992 Oct;6(10):1734-44. 1333056
  2. Gaylinn BD, Harrison JK, Zysk JR, Lyons CE, Lynch KR, Thorner MO: Molecular cloning and expression of a human anterior pituitary receptor for growth hormone-releasing hormone. Mol Endocrinol. 1993 Jan;7(1):77-84. 7680413
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. 12853948
  4. Salvatori R, Fan X, Phillips JA 3rd, Espigares-Martin R, Martin De Lara I, Freeman KL, Plotnick L, Al-Ashwal A, Levine MA: Three new mutations in the gene for the growth hormone (gh)-releasing hormone receptor in familial isolated gh deficiency type ib. J Clin Endocrinol Metab. 2001 Jan;86(1):273-9. 11232012
  5. Salvatori R, Hayashida CY, Aguiar-Oliveira MH, Phillips JA 3rd, Souza AH, Gondo RG, Toledo SP, Conceicao MM, Prince M, Maheshwari HG, Baumann G, Levine MA: Familial dwarfism due to a novel mutation of the growth hormone-releasing hormone receptor gene. J Clin Endocrinol Metab. 1999 Mar;84(3):917-23. 10084571
  6. Carakushansky M, Whatmore AJ, Clayton PE, Shalet SM, Gleeson HK, Price DA, Levine MA, Salvatori R: A new missense mutation in the growth hormone-releasing hormone receptor gene in familial isolated GH deficiency. Eur J Endocrinol. 2003 Jan;148(1):25-30. 12534354
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974