You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameDNA topoisomerase 2-beta
Synonyms
  • 5.99.1.3
  • DNA topoisomerase II, beta isozyme
Gene NameTOP2B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004762|DNA topoisomerase 2-beta
MAKSGGCGAGAGVGGGNGALTWVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQ
LEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRD
KNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVT
GGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITF
QPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKL
DETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIE
VVKKKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFF
KAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLIL
TEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYK
KSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVK
ASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFR
YAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFI
NKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHH
GEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFP
AVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRM
LDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQV
LEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNS
MVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKI
QGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDETQNQHDDSSSDSGTPSG
PDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVE
SQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKK
KKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTS
SGKPSAKKVKKRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDD
DADDDDDDNNDLEELKVKASPITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSLHDKK
SQDFGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPS
SDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNP
GRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYFAESDEEEDDV
DFAMFN
Number of residues1626
Molecular Weight183265.825
Theoretical pI8.16
GO Classification
Functions
  • protein heterodimerization activity
  • protein kinase C binding
  • DNA topoisomerase type II (ATP-hydrolyzing) activity
  • ATP binding
  • histone deacetylase binding
  • DNA binding, bending
  • chromatin binding
  • metal ion binding
  • enzyme binding
  • protein C-terminus binding
Processes
  • axonogenesis
  • forebrain development
  • neuron migration
  • mitotic recombination
  • DNA topological change
  • sister chromatid segregation
  • DNA unwinding involved in DNA replication
  • mitotic DNA integrity checkpoint
  • resolution of meiotic recombination intermediates
Components
  • cytoplasm
  • nucleus
  • DNA topoisomerase complex (ATP-hydrolyzing)
  • cytosol
  • nucleoplasm
General FunctionProtein kinase c binding
Specific FunctionControl of topological states of DNA by transient breakage and subsequent rejoining of DNA strands. Topoisomerase II makes double-strand breaks.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ02880
UniProtKB Entry NameTOP2B_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0020612|DNA topoisomerase 2-beta (TOP2B)
ATGGCCAAGTCGGGTGGCTGCGGCGCGGGAGCCGGCGTGGGCGGCGGCAACGGGGCACTG
ACCTGGGTGAACAATGCTGCAAAAAAAGAAGAGTCAGAAACTGCCAACAAAAATGATTCT
TCAAAGAAGTTGTCTGTTGAGAGAGTGTATCAGAAGAAGACACAACTTGAACACATTCTT
CTTCGTCCTGATACATATATTGGGTCAGTGGAGCCATTGACGCAGTTCATGTGGGTGTAT
GATGAAGATGTAGGAATGAATTGCAGGGAGGTTACCTTTGTGCCAGGTTTATACAAGATC
TTTGATGAAATTTTGGTTAATGCTGCTGACAATAAACAGAGGGATAAGAACATGACTTGT
ATTAAAGTTTCTATTGATCCTGAATCTAACATTATAAGCATTTGGAATAATGGGAAAGGC
ATTCCAGTAGTAGAACACAAGGTAGAGAAAGTTTATGTTCCTGCTTTAATTTTTGGACAG
CTTTTAACATCCAGTAACTATGATGATGATGAGAAAAAAGTTACAGGTGGTCGTAATGGT
TATGGTGCAAAACTTTGTAATATTTTCAGTACAAAGTTTACAGTAGAAACAGCTTGCAAA
GAATACAAACACAGTTTTAAGCAGACATGGATGAATAATATGATGAAGACTTCTGAAGCC
AAAATTAAACATTTTGATGGTGAAGATTACACATGCATAACATTCCAACCAGATCTGTCC
AAATTTAAGATGGAAAAACTTGACAAGGATATTGTGGCCCTCATGACTAGAAGGGCATAT
GATTTGGCTGGTTCGTGTAGAGGGGTCAAGGTCATGTTTAATGGAAAGAAATTGCCTGTA
AATGGATTTCGCAGTTATGTAGATCTTTATGTGAAAGACAAATTGGATGAAACTGGGGTG
GCCCTGAAAGTTATTCATGAGCTTGCAAATGAAAGATGGGATGTTTGTCTCACATTGAGT
GAAAAAGGATTCCAGCAAATCAGCTTTGTAAATAGTATTGCAACTACAAAAGGTGGACGG
CACGTGGATTATGTGGTAGATCAAGTTGTTGGTAAACTGATTGAAGTAGTTAAGAAAAAG
AACAAAGCTGGTGTATCAGTGAAACCATTTCAAGTAAAAAACCATATATGGGTTTTTATT
AATTGCCTTATTGAAAATCCAACTTTTGATTCTCAGACTAAGGAAAACATGACTCTGCAG
CCCAAAAGTTTTGGGTCTAAATGCCAGCTGTCAGAAAAATTTTTTAAAGCAGCCTCTAAT
TGTGGCATTGTAGAAAGTATCCTGAACTGGGTGAAATTTAAGGCTCAGACTCAGCTGAAT
AAGAAGTGTTCATCAGTAAAATACAGTAAAATCAAAGGTATTCCCAAACTGGATGATGCT
AATGATGCTGGTGGTAAACATTCCCTGGAGTGTACACTGATATTAACAGAGGGAGACTCT
GCCAAATCACTGGCTGTGTCTGGATTAGGTGTGATTGGACGAGACAGATACGGAGTTTTT
CCACTCAGGGGCAAAATTCTTAATGTACGGGAAGCTTCTCATAAACAGATCATGGAAAAT
GCTGAAATAAATAATATTATTAAAATAGTTGGTCTACAATATAAGAAAAGTTACGATGAT
GCAGAATCTCTGAAAACCTTACGCTATGGAAAGATTATGATTATGACCGATCAGGATCAA
GATGGTTCTCACATAAAAGGCCTGCTTATTAATTTCATCCATCACAATTGGCCATCACTT
TTGAAGCATGGTTTTCTTGAAGAGTTCATTACTCCTATTGTAAAGGCAAGCAAAAATAAG
CAGGAACTTTCCTTCTACAGTATTCCTGAATTTGACGAATGGAAAAAACATATAGAAAAC
CAGAAAGCCTGGAAAATAAAGTACTATAAAGGATTGGGTACTAGTACAGCTAAAGAAGCA
AAGGAATATTTTGCTGATATGGAAAGGCATCGCATCTTGTTTAGATATGCTGGTCCTGAA
GATGATGCTGCCATTACCTTGGCATTTAGTAAGAAGAAGATTGATGACAGAAAAGAATGG
TTAACAAATTTTATGGAAGACCGGAGACAGCGTAGGCTACATGGCTTACCAGAGCAATTT
TTATATGGTACTGCAACAAAGCATTTGACTTATAATGATTTCATCAACAAGGAATTGATT
CTCTTCTCAAACTCAGACAATGAAAGATCTATACCATCTCTTGTTGATGGCTTTAAACCT
GGCCAGCGGAAAGTTTTATTTACCTGTTTCAAGAGGAATGATAAACGTGAAGTAAAAGTT
GCCCAGTTGGCTGGCTCTGTTGCTGAGATGTCGGCTTATCATCATGGAGAACAAGCATTG
ATGATGACTATTGTGAATTTGGCTCAGAACTTTGTGGGAAGTAACAACATTAACTTGCTT
CAGCCTATTGGTCAGTTTGGAACTCGGCTTCATGGTGGCAAAGATGCTGCAAGCCCTCGT
TATATTTTCACAATGTTAAGCACTTTAGCAAGGCTACTTTTTCCTGCTGTGGATGACAAC
CTCCTTAAGTTCCTTTATGATGATAATCAACGTGTAGAGCCTGAGTGGTATATTCCTATA
ATTCCCATGGTTTTAATAAATGGTGCTGAGGGCATTGGTACTGGATGGGCTTGTAAACTA
CCCAACTATGATGCTAGGGAAATTGTGAACAATGTCAGACGAATGCTAGATGGCCTGGAT
CCTCATCCCATGCTTCCAAACTACAAAAACTTTAAAGGCACGATTCAAGAACTTGGTCAA
AACCAGTATGCAGTCAGTGGTGAAATATTTGTAGTGGACAGAAACACAGTAGAAATTACA
GAGCTTCCAGTTAGAACTTGGACACAGGTATATAAAGAACAGGTTTTAGAACCTATGCTA
AATGGAACAGATAAAACACCAGCATTAATTTCTGATTATAAAGAATATCATACTGACACA
ACTGTGAAATTTGTGGTGAAAATGACTGAAGAGAAACTAGCACAAGCAGAAGCTGCTGGA
CTGCATAAAGTTTTTAAACTTCAAACTACTCTTACTTGTAATTCCATGGTACTTTTTGAT
CATATGGGATGTCTGAAGAAATATGAAACTGTGCAAGACATTCTGAAAGAATTCTTTGAT
TTACGATTAAGTTATTACGGTTTACGTAAGGAGTGGCTTGTGGGAATGTTGGGAGCAGAA
TCTACAAAGCTTAACAATCAAGCCCGTTTCATTTTAGAGAAGATACAAGGGAAAATTACT
ATAGAGAATAGGTCAAAGAAAGATTTGATTCAAATGTTAGTCCAGAGAGGTTATGAATCT
GACCCAGTGAAAGCCTGGAAAGAAGCACAAGAAAAGGCAGCAGAAGAGGATGAAACACAA
AACCAGCATGATGATAGTTCCTCCGATTCAGGAACTCCTTCAGGCCCAGATTTTAATTAT
ATTTTAAATATGTCTCTGTGGTCTCTTACTAAAGAAAAAGTTGAAGAACTGATTAAACAG
AGAGATGCAAAAGGGCGAGAGGTCAATGATCTTAAAAGAAAATCTCCTTCAGATCTTTGG
AAAGAGGATTTAGCGGCATTTGTTGAAGAACTGGATAAAGTGGAATCTCAAGAACGAGAA
GATGTTCTGGCTGGAATGTCTGGAAAAGCAATTAAAGGTAAAGTTGGCAAACCTAAGGTG
AAGAAACTCCAGTTGGAAGAGACAATGCCCTCACCTTATGGCAGAAGAATAATTCCTGAA
ATTACAGCTATGAAGGCAGATGCCAGCAAAAAGTTGCTGAAGAAGAAGAAGGGTGATCTT
GATACTGCAGCAGTAAAAGTGGAATTTGATGAAGAATTCAGTGGAGCACCAGTAGAAGGT
GCAGGAGAAGAGGCATTGACTCCATCAGTTCCTATAAATAAAGGTCCCAAACCTAAGAGG
GAGAAGAAGGAGCCTGGTACCAGAGTGAGAAAAACACCTACATCATCTGGTAAACCTAGT
GCAAAGAAAGTGAAGAAACGGAATCCTTGGTCAGATGATGAATCCAAGTCAGAAAGTGAT
TTGGAAGAAACAGAACCTGTGGTTATTCCAAGAGATTCTTTGCTTAGGAGAGCAGCAGCC
GAAAGACCTAAATACACATTTGATTTCTCAGAAGAAGAGGATGATGATGCTGATGATGAT
GATGATGACAATAATGATTTAGAGGAATTGAAAGTTAAAGCATCTCCCATAACAAATGAT
GGGGAAGATGAATTTGTTCCTTCAGATGGGTTAGATAAAGATGAATATACATTTTCACCA
GGCAAATCAAAAGCCACTCCAGAAAAATCTTTGCATGACAAAAAAAGTCAGGATTTTGGA
AATCTCTTCTCATTTCCTTCATATTCTCAGAAGTCAGAAGATGATTCAGCTAAATTTGAC
AGTAATGAAGAAGATTCTGCTTCTGTTTTTTCACCATCATTTGGTCTGAAACAGACAGAT
AAAGTTCCAAGTAAAACGGTAGCTGCTAAAAAGGGAAAACCGTCTTCAGATACAGTCCCT
AAGCCCAAGAGAGCCCCAAAACAGAAGAAAGTAGTAGAGGCTGTAAACTCTGACTCGGAT
TCAGAATTTGGCATTCCAAAGAAGACTACAACACCAAAAGGTAAAGGCCGAGGGGCAAAG
AAAAGGAAAGCATCTGGCTCTGAAAATGAAGGCGATTATAACCCTGGCAGGAAAACATCC
AAAACAACAAGCAAGAAACCGAAGAAGACATCTTTTGATCAGGATTCAGATGTGGACATC
TTCCCCTCAGACTTCCCTACTGAGCCACCTTCTCTGCCACGAACCGGTCGGGCTAGGAAA
GAAGTAAAATATTTTGCAGAGTCTGATGAAGAAGAAGATGATGTTGATTTTGCAATGTTT
AATTAA
GenBank Gene IDX68060
GeneCard IDNot Available
GenAtlas IDTOP2B
HGNC IDHGNC:11990
Chromosome Location3
Locus3p24
References
  1. Jenkins JR, Ayton P, Jones T, Davies SL, Simmons DL, Harris AL, Sheer D, Hickson ID: Isolation of cDNA clones encoding the beta isozyme of human DNA topoisomerase II and localisation of the gene to chromosome 3p24. Nucleic Acids Res. 1992 Nov 11;20(21):5587-92. 1333583
  2. Austin CA, Sng JH, Patel S, Fisher LM: Novel HeLa topoisomerase II is the II beta isoform: complete coding sequence and homology with other type II topoisomerases. Biochim Biophys Acta. 1993 Mar 20;1172(3):283-91. 8383537
  3. Chung TD, Drake FH, Tan KB, Per SR, Crooke ST, Mirabelli CK: Characterization and immunological identification of cDNA clones encoding two human DNA topoisomerase II isozymes. Proc Natl Acad Sci U S A. 1989 Dec;86(23):9431-5. 2556712
  4. Sng JH, Heaton VJ, Bell M, Maini P, Austin CA, Fisher LM: Molecular cloning and characterization of the human topoisomerase IIalpha and IIbeta genes: evidence for isoform evolution through gene duplication. Biochim Biophys Acta. 1999 Mar 19;1444(3):395-406. 10095062
  5. Austin CA, Fisher LM: Isolation and characterization of a human cDNA clone encoding a novel DNA topoisomerase II homologue from HeLa cells. FEBS Lett. 1990 Jun 18;266(1-2):115-7. 2163884
  6. Yuwen H, Hsia CC, Nakashima Y, Evangelista A, Tabor E: Binding of wild-type p53 by topoisomerase II and overexpression of topoisomerase II in human hepatocellular carcinoma. Biochem Biophys Res Commun. 1997 May 8;234(1):194-7. 9168988
  7. Davies SL, Jenkins JR, Hickson ID: Human cells express two differentially spliced forms of topoisomerase II beta mRNA. Nucleic Acids Res. 1993 Aug 11;21(16):3719-23. 8396237
  8. West KL, Meczes EL, Thorn R, Turnbull RM, Marshall R, Austin CA: Mutagenesis of E477 or K505 in the B' domain of human topoisomerase II beta increases the requirement for magnesium ions during strand passage. Biochemistry. 2000 Feb 15;39(6):1223-33. 10684600
  9. Mirski SE, Bielawski JC, Cole SP: Identification of functional nuclear export sequences in human topoisomerase IIalpha and beta. Biochem Biophys Res Commun. 2003 Jul 11;306(4):905-11. 12821127
  10. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  11. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. 16964243
  12. Giorgianni F, Zhao Y, Desiderio DM, Beranova-Giorgianni S: Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line. Electrophoresis. 2007 Jun;28(12):2027-34. 17487921
  13. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. 17525332
  14. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. 18220336
  15. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. 19367720
  16. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  17. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  18. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  19. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  20. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  21. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  22. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  23. Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC: Uncovering global SUMOylation signaling networks in a site-specific manner. Nat Struct Mol Biol. 2014 Oct;21(10):927-36. doi: 10.1038/nsmb.2890. Epub 2014 Sep 14. 25218447
  24. Wu CC, Li TK, Farh L, Lin LY, Lin TS, Yu YJ, Yen TJ, Chiang CW, Chan NL: Structural basis of type II topoisomerase inhibition by the anticancer drug etoposide. Science. 2011 Jul 22;333(6041):459-62. doi: 10.1126/science.1204117. 21778401