You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeuronal acetylcholine receptor subunit beta-3
SynonymsNot Available
Gene NameCHRNB3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017146|Neuronal acetylcholine receptor subunit beta-3
MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGL
KISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFEN
ADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTM
VDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFL
IIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYL
LFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPE
KEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH
Number of residues458
Molecular Weight52728.215
Theoretical pI8.29
GO Classification
Functions
  • drug binding
  • acetylcholine-activated cation-selective channel activity
  • channel activity
  • acetylcholine binding
Processes
  • synaptic transmission, cholinergic
  • neuromuscular synaptic transmission
  • protein heterooligomerization
  • response to nicotine
  • regulation of membrane potential
  • transport
  • cation transmembrane transport
  • signal transduction
  • neurological system process
  • synaptic transmission
  • transmembrane transport
Components
  • neuron projection
  • postsynaptic membrane
  • acetylcholine-gated channel complex
  • plasma membrane
  • cell junction
  • integral component of membrane
  • synapse
General FunctionDrug binding
Specific FunctionAfter binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Pfam Domain Function
Transmembrane Regions233-257 265-282 299-320 429-447
GenBank Protein ID1458124
UniProtKB IDQ05901
UniProtKB Entry NameACHB3_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0017147|Neuronal acetylcholine receptor subunit beta-3 (CHRNB3)
ATGCTCCCAGATTTTATGCTGGTTCTCATCGTCCTTGGCATCCCTTCCTCAGCCACCACA
GGTTTCAACTCAATCGCCGAAAATGAAGATGCCCTCCTCAGACATTTGTTCCAAGGTTAT
CAGAAATGGGTCCGCCCTGTATTACATTCTAATGACACCATAAAAGTATATTTTGGATTG
AAAATATCCCAGCTTGTAGATGTGGATGAAAAGAATCAGCTGATGACAACCAATGTGTGG
CTCAAACAGGAATGGACAGACCACAAGTTACGCTGGAATCCTGATGATTATGGTGGGATC
CATTCCATTAAAGTTCCATCAGAATCTCTGTGGCTTCCTGACATAGTTCTCTTTGAAAAT
GCTGACGGCCGCTTCGAAGGCTCCCTGATGACCAAGGTCATCGTGAAATCAAACGGAACT
GTTGTCTGGACCCCTCCCGCCAGCTACAAAAGCTCCTGCACCATGGACGTCACGTTTTTC
CCGTTCGACCGACAGAACTGCTCCATGAAGTTTGGATCCTGGACTTATGATGGCACCATG
GTTGACCTCATTTTGATCAATGAAAATGTCGACAGAAAAGACTTCTTCGATAACGGAGAA
TGGGAAATACTGAACGCAAAGGGGATGAAGGGGAACAGAAGGGACGGCGTGTACTCCTAT
CCCTTTATCACGTATTCCTTCGTCCTGAGACGCCTGCCTTTATTCTATACCCTCTTTCTC
ATCATCCCCTGCCTGGGGCTGTCTTTCCTAACAGTTCTTGTGTTCTATTTACCTTCGGAT
GAAGGAGAAAAACTTTCATTATCCACATCGGTCTTGGTTTCTCTGACAGTTTTCCTTTTA
GTGATTGAAGAAATCATCCCATCGTCTTCCAAAGTCATTCCTCTCATTGGAGAGTACCTG
CTGTTCATCATGATTTTTGTGACCCTGTCCATCATTGTTACCGTGTTTGTCATTAACGTT
CACCACAGATCTTCTTCCACGTACCACCCCATGGCCCCCTGGGTTAAGAGGCTCTTTCTG
CAGAAACTTCCAAAATTACTTTGCATGAAAGATCATGTGGATCGCTACTCATCCCCAGAG
AAAGAGGAGAGTCAACCAGTAGTGAAAGGCAAAGTCCTCGAAAAAAAGAAACAGAAACAG
CTTAGTGATGGAGAAAAAGTTCTAGTTGCTTTTTTGGAAAAAGCTGCTGATTCCATTAGA
TACATTTCGAGACATGTGAAGAAAGAACATTTTATCAGCCAGGTAGTACAAGACTGGAAA
TTTGTAGCTCAAGTTCTTGACCGAATCTTCCTGTGGCTCTTTCTGATAGTGTCAGTAACA
GGCTCGGTTCTGATTTTTACCCCTGCTTTGAAGATGTGGCTACATAGTTACCATTAG
GenBank Gene IDU62438
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1963
Chromosome Location8
Locus8p11.2
References
  1. Elliott KJ, Ellis SB, Berckhan KJ, Urrutia A, Chavez-Noriega LE, Johnson EC, Velicelebi G, Harpold MM: Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits. J Mol Neurosci. 1996 Fall;7(3):217-28. 8906617
  2. Groot Kormelink PJ, Luyten WH: Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 1997 Jan 6;400(3):309-14. 9009220
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Willoughby JJ, Ninkina NN, Beech MM, Latchman DS, Wood JN: Molecular cloning of a human neuronal nicotinic acetylcholine receptor beta 3-like subunit. Neurosci Lett. 1993 Jun 11;155(2):136-9. 7690916