You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamyl aminopeptidase
Synonyms
  • 3.4.11.7
  • Aminopeptidase A
  • AP-A
  • Differentiation antigen gp160
  • EAP
Gene NameENPEP
OrganismHuman
Amino acid sequence
>lcl|BSEQ0011634|Glutamyl aminopeptidase
MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL
PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS
ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS
SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK
ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME
NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS
KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR
QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID
DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF
QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV
NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG
Number of residues957
Molecular Weight109243.58
Theoretical pI5.18
GO Classification
Functions
  • metallopeptidase activity
  • aminopeptidase activity
  • metalloaminopeptidase activity
  • peptide binding
  • zinc ion binding
Processes
  • proteolysis
  • angiotensin maturation
  • cell-cell signaling
  • peptide catabolic process
  • angiotensin catabolic process in blood
  • cell proliferation
  • glomerulus development
  • cell migration
  • cellular protein metabolic process
  • regulation of systemic arterial blood pressure by renin-angiotensin
  • angiogenesis
Components
  • lysosomal membrane
  • apical part of cell
  • plasma membrane
  • brush border
  • cytoplasmic vesicle
  • extracellular exosome
  • external side of plasma membrane
  • integral component of plasma membrane
  • apical plasma membrane
General FunctionZinc ion binding
Specific FunctionAppears to have a role in the catabolic pathway of the renin-angiotensin system. Probably plays a role in regulating growth and differentiation of early B-lineage cells.
Pfam Domain Function
Transmembrane Regions19-39
GenBank Protein ID291854
UniProtKB IDQ07075
UniProtKB Entry NameAMPE_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0011635|Glutamyl aminopeptidase (ENPEP)
ATGAACTTTGCGGAGAGAGAGGGCTCTAAGAGATACTGCATTCAAACGAAACATGTGGCC
ATTCTCTGTGCGGTGGTGGTGGGTGTAGGATTAATAGTGGGACTTGCCGTGGGCTTGACC
AGATCGTGTGACTCCAGCGGGGACGGCGGGCCGGGCACTGCGCCAGCTCCTTCCCACCTG
CCTTCTTCCACGGCCAGCCCCTCAGGTCCTCCTGCCCAGGACCAGGACATCTGCCCGGCC
AGTGAGGATGAGAGCGGACAGTGGAAAAACTTTCGACTGCCGGACTTCGTCAACCCAGTC
CACTACGACCTGCACGTGAAGCCCCTGTTGGAGGAGGACACCTACACGGGCACCGTGAGC
ATCTCCATCAACCTGAGCGCTCCCACCCGGTACCTGTGGCTGCACCTCCGGGAGACCAGG
ATCACCCGGCTCCCGGAGCTGAAGAGGCCCTCTGGGGACCAGGTGCAAGTCCGGAGGTGT
TTCGAGTACAAAAAGCAGGAGTACGTGGTGGTCGAGGCGGAGGAAGAGCTTACCCCCAGC
AGTGGAGATGGCCTGTATCTCCTGACCATGGAGTTCGCCGGCTGGCTGAACGGCTCCCTC
GTGGGATTTTATAGAACCACCTACACGGAGAACGGACAAGTCAAGAGCATAGTGGCCACC
GATCATGAACCAACAGATGCCAGGAAATCTTTTCCTTGTTTTGATGAGCCCAACAAAAAG
GCAACTTATACAATATCTATCACCCATCCCAAAGAATACGGAGCACTTTCAAATATGCCA
GTGGCGAAAGAAGAGTCAGTGGATGATAAATGGACTCGAACAACTTTTGAGAAGTCTGTC
CCCATGAGCACGTACCTGGTGTGCTTTGCTGTACATCAATTTGACTCTGTAAAGAGAATA
TCAAATAGTGGAAAACCTCTTACAATTTATGTCCAGCCAGAGCAAAAGCACACAGCCGAA
TATGCTGCAAACATAACTAAAAGTGTGTTTGATTATTTTGAAGAATACTTTGCTATGAAT
TATTCTCTTCCTAAATTAGATAAAATCGCTATTCCAGATTTTGGCACTGGTGCCATGGAG
AACTGGGGACTCATCACGTACAGAGAAACGAACCTGCTTTATGACCCTAAGGAATCAGCC
TCATCAAACCAACAGAGGGTGGCCACTGTGGTTGCCCATGAACTTGTGCATCAGTGGTTT
GGAAATATTGTGACCATGGACTGGTGGGAAGACTTGTGGCTAAATGAAGGATTTGCTTCT
TTCTTTGAGTTTCTGGGAGTAAACCATGCAGAAACAGACTGGCAAATGCGTGACCAAATG
TTACTTGAAGATGTATTACCTGTTCAAGAGGATGATTCTTTGATGTCTTCGCATCCAATT
ATTGTGACTGTGACAACCCCTGATGAAATAACATCTGTTTTTGATGGAATATCCTATAGC
AAGGGATCTTCTATTTTGAGAATGCTTGAAGACTGGATAAAACCAGAGAATTTTCAAAAA
GGATGTCAGATGTACTTGGAAAAATACCAATTCAAGAATGCAAAAACTTCTGATTTTTGG
GCAGCACTGGAAGAGGCAAGTAGGCTACCAGTGAAAGAAGTAATGGACACCTGGACCAGA
CAGATGGGTTATCCTGTGCTTAACGTGAACGGTGTCAAGAACATCACACAGAAACGCTTT
TTGTTGGACCCAAGAGCTAACCCTTCTCAGCCCCCTTCAGATCTTGGTTATACATGGAAT
ATCCCAGTTAAATGGACTGAAGATAATATAACAAGCAGTGTGTTATTTAATAGGTCAGAA
AAAGAAGGAATCACTTTGAACTCCTCTAATCCTAGTGGAAATGCTTTTCTCAAAATAAAC
CCAGATCATATTGGGTTTTATCGTGTAAATTATGAAGTAGCAACTTGGGACTCGATAGCT
ACAGCGCTCTCCTTGAACCACAAGACATTTTCTTCAGCAGATCGTGCAAGTCTTATTGAT
GATGCTTTTGCCTTGGCAAGAGCTCAACTTCTAGATTATAAGGTGGCTTTGAACTTGACC
AAGTATCTCAAAAGGGAAGAGAATTTTTTACCATGGCAGAGAGTAATTTCAGCTGTAACC
TACATCATTAGCATGTTTGAAGATGATAAAGAGCTATATCCTATGATTGAGGAATACTTC
CAAGGTCAAGTGAAGCCTATTGCAGATTCTCTGGGATGGAATGATGCTGGAGACCATGTC
ACAAAGTTACTCCGTTCCTCCGTGTTAGGGTTTGCGTGCAAGATGGGAGACAGAGAAGCC
TTGAACAATGCTTCCTCGTTATTTGAGCAGTGGCTAAATGGGACTGTAAGCCTTCCCGTA
AATCTCAGGCTTCTGGTGTATCGGTATGGGATGCAGAACTCTGGCAATGAGATTTCATGG
AACTACACTCTTGAGCAATACCAGAAAACTTCATTAGCTCAAGAAAAAGAAAAACTGCTG
TATGGATTAGCATCAGTGAAGAACGTTACTCTTTTGTCAAGGTATTTGGATTTGCTCAAG
GACACGAACCTTATTAAAACTCAGGATGTGTTTACAGTCATTCGATATATCTCATATAAC
AGCTATGGGAAGAACATGGCCTGGAATTGGATACAACTCAACTGGGACTATCTAGTCAAC
AGATATACACTCAATAACAGAAACCTTGGCCGAATTGTCACAATAGCAGAGCCATTCAAC
ACTGAACTGCAACTGTGGCAGATGGAGAGCTTTTTTGCAAAATATCCACAAGCTGGAGCA
GGAGAAAAACCTAGGGAACAAGTGCTGGAAACAGTGAAAAACAATATAGAGTGGCTAAAA
CAACATAGAAACACCATCAGAGAATGGTTTTTTAATTTACTTGAGAGTGGTTAA
GenBank Gene IDL14721
GeneCard IDNot Available
GenAtlas IDENPEP
HGNC IDHGNC:3355
Chromosome Location4
Locus4q25
References
  1. Nanus DM, Engelstein D, Gastl GA, Gluck L, Vidal MJ, Morrison M, Finstad CL, Bander NH, Albino AP: Molecular cloning of the human kidney differentiation antigen gp160: human aminopeptidase A. Proc Natl Acad Sci U S A. 1993 Aug 1;90(15):7069-73. 8346219
  2. Li L, Wang J, Cooper MD: cDNA cloning and expression of human glutamyl aminopeptidase (aminopeptidase A). Genomics. 1993 Sep;17(3):657-64. 8244382
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  6. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  8. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974