You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameVoltage-dependent L-type calcium channel subunit beta-2
Synonyms
  • CAB2
  • CACNLB2
  • Calcium channel voltage-dependent subunit beta 2
  • Lambert-Eaton myasthenic syndrome antigen B
  • MYSB
Gene NameCACNB2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004623|Voltage-dependent L-type calcium channel subunit beta-2
MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTS
SDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVR
TNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLE
NMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIP
ANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMM
QKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIER
IFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLN
VQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTL
ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHN
HRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH
RHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ
Number of residues660
Molecular Weight73579.925
Theoretical pI8.26
GO Classification
Functions
  • calcium channel regulator activity
  • voltage-gated calcium channel activity
  • calcium channel activity
Processes
  • transport
  • synaptic transmission
  • visual perception
  • axon guidance
  • neuromuscular junction development
  • regulation of voltage-gated calcium channel activity
  • calcium ion import
  • positive regulation of calcium ion transport
Components
  • L-type voltage-gated calcium channel complex
  • voltage-gated calcium channel complex
  • integral component of plasma membrane
General FunctionVoltage-gated calcium channel activity
Specific FunctionThe beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID300417
UniProtKB IDQ08289
UniProtKB Entry NameCACB2_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0021669|Voltage-dependent L-type calcium channel subunit beta-2 (CACNB2)
ATGCAGTGCTGCGGGCTGGTGCATCGCCGGCGAGTACGGGTGTCCTATGGTTCGGCAGAC
TCCTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTG
CGCAGAGAAGCGGAGCGGCAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTT
GCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTG
CCTGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAAC
AATGACTGGTGGATAGGGCGATTGGTAAAAGAAGGCTGTGAAATCGGATTCATTCCAAGC
CCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGAGCCAAGCAAGGGAAATTC
TACTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCC
AGAAAATCAACACCTCCATCATCTGCTATAGACATAGATGCTACTGGCTTAGATGCAGAA
GAAAATGATATTCCAGCAAACCACCGCTCCCCTAAACCCAGTGCAAACAGTGTAACGTCA
CCCCACTCCAAAGAGAAAAGAATGCCCTTCTTTAAGAAGACAGAGCACACTCCTCCGTAT
GATGTGGTACCTTCCATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAG
GTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAACACAGATTTGAAGGGCGG
ATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAAT
CCCAGTAAGCACGCAATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAG
AGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAGTTGGTGGTCCTTGACGCG
GATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATAT
GTAAAGATTTCTTCTCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAA
GCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAG
CTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGAC
TATCTGGAGGCCTACTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTC
CTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCA
CAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAA
GCTGAAGAAGAACCTAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCA
GCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTT
GACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCC
CATGACCACGTGGACCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCAC
GGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAG
CAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGT
GAAAAGGATGGAGAAGTGATATCAAAAAAACGGAATGAGGCTGGGGAGTGGAACAGGGAT
GTTTACATCCGCCAATGA
GenBank Gene IDS60415
GeneCard IDNot Available
GenAtlas IDCACNB2
HGNC IDHGNC:1402
Chromosome Location10
Locus10p12
References
  1. Rosenfeld MR, Wong E, Dalmau J, Manley G, Posner JB, Sher E, Furneaux HM: Cloning and characterization of a Lambert-Eaton myasthenic syndrome antigen. Ann Neurol. 1993 Jan;33(1):113-20. 8494331
  2. Taviaux S, Williams ME, Harpold MM, Nargeot J, Lory P: Assignment of human genes for beta 2 and beta 4 subunits of voltage-dependent Ca2+ channels to chromosomes 10p12 and 2q22-q23. Hum Genet. 1997 Aug;100(2):151-4. 9254841
  3. Colecraft HM, Alseikhan B, Takahashi SX, Chaudhuri D, Mittman S, Yegnasubramanian V, Alvania RS, Johns DC, Marban E, Yue DT: Novel functional properties of Ca(2+) channel beta subunits revealed by their expression in adult rat heart cells. J Physiol. 2002 Jun 1;541(Pt 2):435-52. 12042350
  4. Foell JD, Balijepalli RC, Delisle BP, Yunker AM, Robia SL, Walker JW, McEnery MW, January CT, Kamp TJ: Molecular heterogeneity of calcium channel beta-subunits in canine and human heart: evidence for differential subcellular localization. Physiol Genomics. 2004 Apr 13;17(2):183-200. 14762176
  5. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Yada H, Murata M, Shimoda K, Yuasa S, Kawaguchi H, Ieda M, Adachi T, Murata M, Ogawa S, Fukuda K: Dominant negative suppression of Rad leads to QT prolongation and causes ventricular arrhythmias via modulation of L-type Ca2+ channels in the heart. Circ Res. 2007 Jul 6;101(1):69-77. Epub 2007 May 24. 17525370
  8. Rahimi N, Rezazadeh K, Mahoney JE, Hartsough E, Meyer RD: Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis. Mol Biol Cell. 2012 May;23(9):1646-56. doi: 10.1091/mbc.E11-11-0934. Epub 2012 Mar 14. 22419821
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974
  10. Antzelevitch C, Pollevick GD, Cordeiro JM, Casis O, Sanguinetti MC, Aizawa Y, Guerchicoff A, Pfeiffer R, Oliva A, Wollnik B, Gelber P, Bonaros EP Jr, Burashnikov E, Wu Y, Sargent JD, Schickel S, Oberheiden R, Bhatia A, Hsu LF, Haissaguerre M, Schimpf R, Borggrefe M, Wolpert C: Loss-of-function mutations in the cardiac calcium channel underlie a new clinical entity characterized by ST-segment elevation, short QT intervals, and sudden cardiac death. Circulation. 2007 Jan 30;115(4):442-9. Epub 2007 Jan 15. 17224476