You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTyrosine-protein phosphatase non-receptor type 13
Synonyms
  • 3.1.3.48
  • FAP-1
  • Fas-associated protein-tyrosine phosphatase 1
  • hPTPE1
  • PNP1
  • Protein-tyrosine phosphatase 1E
  • Protein-tyrosine phosphatase PTPL1
  • PTP-BAS
  • PTP-E1
  • PTP1E
  • PTPL1
Gene NamePTPN13
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008996|Tyrosine-protein phosphatase non-receptor type 13
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIQKPPLSHQTFLNKGLSKS
MGFLSIKDTQDENYFKDILSDNSGREDSENTFSPYQFKTSGPEKKPIPGIDVLSKKKIWA
SSMDLLCTADRDFSSGETATYRRCHPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKMD
PIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDVFSTSSESPS
IISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIML
KRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFFG
PEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFDM
VVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFRI
KFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
VSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHF
HRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSD
GIKHGFQTDNSKICQYLLHLCSYQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRG
FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSSKEKNDKASWE
EKPREMSKSYHDLSQASLYPHRKNVIVNMEPPPQTVAELVGKPSHQMSRSDAESLAGVTK
LNNSKSVASLNRSPERRKHESDSSSIEDPGQAYVLGMTMHSSGNSSSQVPLKENDVLHKR
WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSVAPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVPSTPVHLTNEMKNYM
KKSSYMQDSAIDSSSKDHHWSRGTLRHISENSFGPSGGLREGSLSSQDSRTESASLSQSQ
VNGFFASHLGDQTWQESQHGSPSPSVISKATEKETFTDSNQSKTKKPGISDVTDYSDRGD
SDMDEATYSSSQDHQTPKQESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKNDNSLGI
SVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPTSKEHVPVTPQCTLSDQNAQGQGPEKVKKTTQVKDYSFVTEENTF
EVKLFKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVILKVNGA
SLKGLSQQEVISALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQVLPNSSKDSSQ
PSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTWSSALH
QTLSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPNKPEFEDSNPSPLPPDMAPGQSYQP
QSESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLEDFELEVELLITLIKSEKGSLG
FTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLRAASKT
VRLVIGRVLELPRIPMLPHLLPDITLTCNKEELGFSLCGGHDSLYQVVYISDINPRSVAA
IEGNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSLVLKATRNDLPVVPSSKRSAVSA
PKSTKGNGSYSVGSCSQPALTPNDSFSTVAGEEINEISYPKGKCSTYQIKGSPNLTLPKE
SYIQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGYSCGPGTLKMNGKLSEERTE
DTDCDGSPLPEYFTEATKMNGCEEYCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIER
TNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENL
QELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEEFVYI
ACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVSNRLRLA
LVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHR
SGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQYIFC
YQVILYVLTRLQAEEEQKQQPQLLK
Number of residues2485
Molecular Weight276903.22
Theoretical pINot Available
GO Classification
Functions
  • phosphatidylinositol 3-kinase regulatory subunit binding
  • protein tyrosine phosphatase activity
Processes
  • protein dephosphorylation
  • peptidyl-tyrosine dephosphorylation
  • regulation of phosphatidylinositol 3-kinase signaling
Components
  • neuron projection
  • cell body
  • lamellipodium
  • cytoplasm
  • cytoskeleton
  • nucleus
  • plasma membrane
  • extracellular exosome
General FunctionProtein tyrosine phosphatase activity
Specific FunctionTyrosine phosphatase which regulates negatively FAS-induced apoptosis and NGFR-mediated pro-apoptotic signaling (PubMed:15611135). May regulate phosphoinositide 3-kinase (PI3K) signaling through dephosphorylation of PIK3R2 (PubMed:23604317).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ12923
UniProtKB Entry NamePTN13_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0020845|Tyrosine-protein phosphatase non-receptor type 13 (PTPN13)
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAA
ATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGC
CTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACT
GCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATCCAC
ATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATT
TACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAATAGC
AATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGACAGATCAGCTTTCCTGTAACAGTGAACAAAAGCCTGATCGAAGCCAGGCTATT
CGAGATCGATTGCGAGGAAAAGGATTACCAACAGGAAGAAGCTCTACTTCTGATGTACTA
GACATACAAAAGCCTCCACTCTCTCATCAGACCTTTCTTAACAAAGGGCTTAGTAAATCT
ATGGGATTTCTGTCCATCAAAGATACACAAGATGAGAATTATTTCAAGGACATTTTATCA
GATAATTCTGGACGTGAAGATTCTGAAAATACATTCTCCCCTTACCAGTTCAAAACTAGT
GGCCCAGAAAAAAAACCCATCCCTGGCATTGATGTGCTTTCTAAGAAGAAGATCTGGGCT
TCATCCATGGACTTGCTTTGTACAGCTGACAGAGACTTCTCTTCAGGAGAGACTGCCACA
TATCGTCGTTGTCACCCTGAGGCAGTAACAGTGCGGACTTCAACTACTCCTAGAAAAAAG
GAGGCAAGATACTCAGATGGAAGTATAGCCTTGGATATCTTTGGCCCTCAGAAAATGGAT
CCAATATATCACACTCGAGAATTGCCCACCTCCTCAGCAATATCAAGTGCTTTGGACCGA
ATCCGAGAGAGACAAAAGAAACTTCAGGTTCTGAGGGAAGCCATGAATGTAGAAGAACCA
GTTCGAAGATACAAAACTTATCATGGTGATGTCTTTAGTACCTCCAGTGAAAGTCCATCT
ATTATTTCCTCTGAATCAGATTTCAGACAAGTGAGAAGAAGTGAAGCCTCAAAGAGGTTT
GAATCCAGCAGTGGTCTCCCAGGGGTAGATGAAACCTTAAGTCAAGGCCAGTCACAGAGA
CCGAGCAGACAATATGAAACACCCTTTGAAGGCAACTTAATTAATCAAGAGATCATGCTA
AAACGGCAAGAGGAAGAACTGATGCAGCTACAAGCCAAAATGGCCCTTAGACAGTCTCGG
TTGAGCCTATATCCAGGAGACACAATCAAAGCGTCCATGCTTGACATCACCAGGGATCCG
TTAAGAGAAATTGCCCTAGAAACAGCCATGACTCAAAGAAAACTGAGGAATTTCTTTGGC
CCTGAGTTTGTGAAAATGACAATTGAACCATTTATATCTTTGGATTTGCCACGGTCTATT
CTTACTAAGAAAGGGAAGAATGAGGATAACCGAAGGAAAGTAAACATAATGCTTCTGAAC
GGGCAAAGACTGGAACTGACCTGTGATACCAAAACTATATGTAAAGATGTGTTTGATATG
GTTGTGGCACATATTGGCTTAGTAGAGCATCATTTGTTTGCTTTAGCTACCCTCAAAGAT
AATGAATATTTCTTTGTTGATCCTGACTTAAAATTAACCAAAGTGGCCCCAGAGGGATGG
AAAGAAGAACCAAAGAAAAAGACCAAAGCCACTGTTAATTTTACTTTGTTTTTCAGAATT
AAATTTTTTATGGATGATGTTAGTCTAATACAACATACTCTGACGTGTCATCAGTATTAC
CTTCAGCTTCGAAAAGATATTTTGGAGGAAAGGATGCACTGTGATGATGAGACTTCCTTA
TTGCTGGCATCCTTGGCTCTCCAGGCTGAGTATGGAGATTATCAACCAGAGGTTCATGGT
GTGTCTTACTTTAGAATGGAGCACTATTTGCCCGCCAGAGTGATGGAGAAACTTGATTTA
TCCTATATCAAAGAAGAGTTACCCAAATTGCATAATACCTATGTGGGAGCTTCTGAAAAA
GAGACAGAGTTAGAATTTTTAAAGGTCTGCCAAAGACTGACAGAATATGGAGTTCATTTT
CACCGAGTGCACCCTGAGAAGAAGTCACAAACAGGAATATTGCTTGGAGTCTGTTCTAAA
GGTGTCCTTGTGTTTGAAGTTCACAATGGAGTGCGCACATTGGTCCTTCGCTTTCCATGG
AGGGAAACCAAGAAAATATCTTTTTCTAAAAAGAAAATCACATTGCAAAATACATCAGAT
GGAATAAAACATGGCTTCCAGACAGACAACAGTAAGATATGCCAGTACCTGCTGCACCTC
TGCTCTTACCAGCATAAGTTCCAGCTACAGATGAGAGCAAGACAGAGCAACCAAGATGCC
CAAGATATTGAGAGAGCTTCGTTTAGGAGCCTGAATCTCCAAGCAGAGTCTGTTAGAGGA
TTTAATATGGGACGAGCAATCAGCACTGGCAGTCTGGCCAGCAGCACCCTCAACAAACTT
GCTGTTCGACCTTTATCAGTTCAAGCTGAGATTCTGAAGAGGCTATCCTGCTCAGAGCTG
TCGCTTTACCAGCCATTGCAAAACAGTTCAAAAGAGAAGAATGACAAAGCTTCATGGGAG
GAAAAGCCTAGAGAGATGAGTAAATCATACCATGATCTCAGTCAGGCCTCTCTCTATCCA
CATCGGAAAAATGTCATTGTTAACATGGAACCCCCACCACAAACCGTTGCAGAGTTGGTG
GGAAAACCTTCTCACCAGATGTCAAGATCTGATGCAGAATCTTTGGCAGGAGTGACAAAA
CTTAATAATTCAAAGTCTGTTGCGAGTTTAAATAGAAGTCCTGAAAGGAGGAAACATGAA
TCAGACTCCTCATCCATTGAAGACCCTGGGCAAGCATATGTTCTAGATGTGCTACACAAA
AGATGGAGCATAGTATCTTCACCAGAAAGGGAGATCACCTTAGTGAACCTGAAAAAAGAT
GCAAAGTATGGCTTGGGATTTCAAATTATTGGTGGGGAGAAGATGGGAAGACTGGACCTA
GGCATATTTATCAGTTCAGTTGCCCCTGGAGGACCAGCTGACTTGGATGGATGCTTGAAG
CCAGGAGACCGTTTGATATCTGTGAATAGTGTGAGTCTGGAGGGAGTCAGCCACCATGCT
GCAATTGAAATTTTGCAAAATGCACCTGAAGATGTGACACTTGTTATCTCTCAGCCAAAA
GAAAAGATATCCAAAGTGCCTTCTACTCCTGTGCATCTCACCAATGAGATGAAAAACTAC
ATGAAGAAATCTTCCTACATGCAAGACAGTGCTATAGATTCTTCTTCCAAGGATCACCAC
TGGTCACGTGGTACCCTGAGGCACATCTCGGAGAACTCCTTTGGGCCATCTGGGGGCCTG
CGGGAAGGAAGCCTGAGTTCTCAAGATTCCAGGACTGAGAGTGCCAGCTTGTCTCAAAGC
CAGGTCAATGGTTTCTTTGCCAGCCATTTAGGTGACCAAACCTGGCAGGAATCACAGCAT
GGCAGCCCTTCCCCATCTGTAATATCCAAAGCCACCGAGAAAGAGACTTTCACTGATAGT
AACCAAAGCAAAACTAAAAAGCCAGGCATTTCTGATGTAACTGATTACTCAGACCGTGGA
GATTCAGACATGGATGAAGCCACTTACTCCAGCAGTCAGGATCATCAAACACCAAAACAG
GAATCTTCCTCTTCAGTGAATACATCCAACAAGATGAATTTTAAAACTTTTTCTTCATCA
CCTCCTAAGCCTGGAGATATCTTTGAGGTTGAACTGGCTAAAAATGATAACAGCTTGGGG
ATAAGTGTCACGGGAGGTGTGAATACGAGTGTCAGACATGGTGGCATTTATGTGAAAGCT
GTTATTCCCCAGGGAGCAGCAGAGTCTGATGGTAGAATTCACAAAGGTGATCGCGTCCTA
GCTGTCAATGGAGTTAGTCTAGAAGGAGCCACCCATAAGCAAGCTGTGGAAACACTGAGA
AATACAGGACAGGTGGTTCATCTGTTATTAGAAAAGGGACAATCTCCAACATCTAAAGAA
CATGTCCCGGTAACCCCACAGTGTACCCTTTCAGATCAGAATGCCCAAGGTCAAGGCCCA
GAAAAAGTGAAGAAAACAACTCAGGTCAAAGACTACAGCTTTGTCACTGAAGAAAATACA
TTTGAGGTAAAATTATTTAAAAATAGCTCAGGTCTAGGATTCAGTTTTTCTCGAGAAGAT
AATCTTATACCGGAGCAAATTAATGCCAGCATAGTAAGGGTTAAAAAGCTCTTTCCTGGA
CAGCCAGCAGCAGAAAGTGGAAAAATTGATGTAGGAGATGTTATCTTGAAAGTGAATGGA
GCCTCTTTGAAAGGACTATCTCAGCAGGAAGTCATATCTGCTCTCAGGGGAACTGCTCCA
GAAGTATTCTTGCTTCTCTGCAGACCTCCACCTGGTGTGCTACCGGAAATTGATACTGCG
CTTTTGACCCCACTTCAGTCTCCAGCACAAGTACTTCCAAACAGCAGTAAAGACTCTTCT
CAGCCATCATGTGTGGAGCAAAGCACCAGCTCAGATGAAAATGAAATGTCAGACAAAAGC
AAAAAACAGTGCAAGTCCCCATCCAGAAGAGACAGTTACAGTGACAGCAGTGGGAGTGGA
GAAGATGACTTAGTGACAGCTCCAGCAAACATATCAAATTCGACCTGGAGTTCAGCTTTG
CATCAGACTCTAAGCAACATGGTATCACAGGCACAGAGTCATCATGAAGCACCCAAGAGT
CAAGAAGATACCATTTGTACCATGTTTTACTATCCTCAGAAAATTCCCAATAAACCAGAG
TTTGAGGACAGTAATCCTTCCCCTCTACCACCGGATATGGCTCCTGGGCAGAGTTATCAA
CCCCAATCAGAATCTGCTTCCTCTAGTTCGATGGATAAGTATCATATACATCACATTTCT
GAACCAACTAGACAAGAAAACTGGACACCTTTGAAAAATGACTTGGAAAATCACCTTGAA
GACTTTGAACTGGAAGTAGAACTCCTCATTACCCTAATTAAATCAGAAAAAGGAAGCCTG
GGTTTTACAGTAACCAAAGGCAATCAGAGAATTGGTTGTTATGTTCATGATGTCATACAG
GATCCAGCCAAAAGTGATGGAAGGCTAAAACCTGGGGACCGGCTCATAAAGGTTAATGAT
ACAGATGTTACTAATATGACTCATACAGATGCAGTTAATCTGCTCCGGGCTGCATCCAAA
ACAGTCAGATTAGTTATTGGACGAGTTCTAGAATTACCCAGAATACCAATGTTGCCTCAT
TTGCTACCGGACATAACACTAACGTGCAACAAAGAGGAGTTGGGTTTTTCCTTATGTGGA
GGTCATGACAGCCTTTATCAAGTGGTATATATTAGTGATATTAATCCAAGGTCCGTCGCA
GCCATTGAGGGTAATCTCCAGCTATTAGATGTCATCCATTATGTGAACGGAGTCAGCACA
CAAGGAATGACCTTGGAGGAAGTTAACAGAGCATTAGACATGTCACTTCCTTCATTGGTA
TTGAAAGCAACAAGAAATGATCTTCCAGTGGTCCCCAGCTCAAAGAGGTCTGCTGTTTCA
GCTCCAAAGTCAACCAAAGGCAATGGTTCCTACAGTGTGGGGTCTTGCAGCCAGCCTGCC
CTCACTCCTAATGATTCATTCTCCACGGTTGCTGGGGAAGAAATAAATGAAATATCGTAC
CCCAAAGGAAAATGTTCTACTTATCAGATAAAGGGATCACCAAACTTGACTCTGCCCAAA
GAATCTTATATACAAGAAGATGACATTTATGATGATTCCCAAGAAGCTGAAGTTATCCAG
TCTCTGCTGGATGTTGTGGATGAGGAAGCCCAGAATCTTTTAAACGAAAATAATGCAGCA
GGATACTCCTGTGGTCCAGGTACATTAAAGATGAATGGGAAGTTATCAGAAGAGAGAACA
GAAGATACAGACTGCGATGGTTCACCTTTACCTGAGTATTTTACTGAGGCCACCAAAATG
AATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCA
CAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAG
AGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCT
GTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCA
GTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAAT
CTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGG
AAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAA
GGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTAC
ATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAG
CAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGC
CAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTG
GCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGAT
ATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCAT
GATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCAC
AGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATT
TGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTG
GTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTC
TGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAG
CAGCCTCAGCTTCTGAAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9646
Chromosome Location4
LocusNot Available
References
  1. Banville D, Ahmad S, Stocco R, Shen SH: A novel protein-tyrosine phosphatase with homology to both the cytoskeletal proteins of the band 4.1 family and junction-associated guanylate kinases. J Biol Chem. 1994 Sep 2;269(35):22320-7. 8071359
  2. Maekawa K, Imagawa N, Nagamatsu M, Harada S: Molecular cloning of a novel protein-tyrosine phosphatase containing a membrane-binding domain and GLGF repeats. FEBS Lett. 1994 Jan 10;337(2):200-6. 8287977
  3. Saras J, Claesson-Welsh L, Heldin CH, Gonez LJ: Cloning and characterization of PTPL1, a protein tyrosine phosphatase with similarities to cytoskeletal-associated proteins. J Biol Chem. 1994 Sep 30;269(39):24082-9. 7929060
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Sato T, Irie S, Kitada S, Reed JC: FAP-1: a protein tyrosine phosphatase that associates with Fas. Science. 1995 Apr 21;268(5209):411-5. 7536343
  6. Irie S, Hachiya T, Rabizadeh S, Maruyama W, Mukai J, Li Y, Reed JC, Bredesen DE, Sato TA: Functional interaction of Fas-associated phosphatase-1 (FAP-1) with p75(NTR) and their effect on NF-kappaB activation. FEBS Lett. 1999 Oct 29;460(2):191-8. 10544233
  7. Honda H, Shibuya M, Chiba S, Yazaki Y, Hirai H: Identification of novel protein-tyrosine phosphatases in a human leukemia cell line, F-36P. Leukemia. 1993 May;7(5):742-6. 8483328
  8. Saras J, Franzen P, Aspenstrom P, Hellman U, Gonez LJ, Heldin CH: A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1. J Biol Chem. 1997 Sep 26;272(39):24333-8. 9305890
  9. Murthy KK, Clark K, Fortin Y, Shen SH, Banville D: ZRP-1, a zyxin-related protein, interacts with the second PDZ domain of the cytosolic protein tyrosine phosphatase hPTP1E. J Biol Chem. 1999 Jul 16;274(29):20679-87. 10400701
  10. Gross C, Heumann R, Erdmann KS: The protein kinase C-related kinase PRK2 interacts with the protein tyrosine phosphatase PTP-BL via a novel PDZ domain binding motif. FEBS Lett. 2001 May 11;496(2-3):101-4. 11356191
  11. Kimber WA, Deak M, Prescott AR, Alessi DR: Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns(3,4)P2-binding adaptor protein TAPP1. Biochem J. 2003 Dec 1;376(Pt 2):525-35. 14516276
  12. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  13. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  14. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  15. Kuchay S, Duan S, Schenkein E, Peschiaroli A, Saraf A, Florens L, Washburn MP, Pagano M: FBXL2- and PTPL1-mediated degradation of p110-free p85beta regulatory subunit controls the PI(3)K signalling cascade. Nat Cell Biol. 2013 May;15(5):472-80. doi: 10.1038/ncb2731. Epub 2013 Apr 21. 23604317
  16. Hagemann N, Ackermann N, Christmann J, Brier S, Yu F, Erdmann KS: The serologically defined colon cancer antigen-3 interacts with the protein tyrosine phosphatase PTPN13 and is involved in the regulation of cytokinesis. Oncogene. 2013 Sep 26;32(39):4602-13. doi: 10.1038/onc.2012.485. Epub 2012 Oct 29. 23108400
  17. Kozlov G, Gehring K, Ekiel I: Solution structure of the PDZ2 domain from human phosphatase hPTP1E and its interactions with C-terminal peptides from the Fas receptor. Biochemistry. 2000 Mar 14;39(10):2572-80. 10704206
  18. Kozlov G, Banville D, Gehring K, Ekiel I: Solution structure of the PDZ2 domain from cytosolic human phosphatase hPTP1E complexed with a peptide reveals contribution of the beta2-beta3 loop to PDZ domain-ligand interactions. J Mol Biol. 2002 Jul 19;320(4):813-20. 12095257
  19. Villa F, Deak M, Bloomberg GB, Alessi DR, van Aalten DM: Crystal structure of the PTPL1/FAP-1 human tyrosine phosphatase mutated in colorectal cancer: evidence for a second phosphotyrosine substrate recognition pocket. J Biol Chem. 2005 Mar 4;280(9):8180-7. Epub 2004 Dec 20. 15611135
  20. Yoshida S, Harada H, Nagai H, Fukino K, Teramoto A, Emi M: Head-to-head juxtaposition of Fas-associated phosphatase-1 (FAP-1) and c-Jun NH2-terminal kinase 3 (JNK3) genes: genomic structure and seven polymorphisms of the FAP-1 gene. J Hum Genet. 2002;47(11):614-9. 12436199