You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAcetyl-CoA carboxylase 1
Synonyms
  • 6.4.1.2
  • ACAC
  • ACC-alpha
  • ACC1
  • ACCA
Gene NameACACA
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037054|Acetyl-CoA carboxylase 1
MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLS
DLGISSLQDGLALHIRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQA
AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
GVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYA
EIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQ
STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSD
MNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
SFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSP
PQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLV
DHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQ
LELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFE
YLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYG
SRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQA
YGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQA
FLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVI
GNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVD
PEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGS
GMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGR
EVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPID
RIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGG
IPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPL
MVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSI
NPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAE
RKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLR
RLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE
EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILST
MDSPST
Number of residues2346
Molecular Weight265551.725
Theoretical pI6.52
GO Classification
Functions
  • ATP binding
  • metal ion binding
  • acetyl-CoA carboxylase activity
  • biotin carboxylase activity
Processes
  • carnitine shuttle
  • tissue homeostasis
  • fatty acid biosynthetic process
  • positive regulation of cellular metabolic process
  • triglyceride biosynthetic process
  • cellular response to prostaglandin E stimulus
  • small molecule metabolic process
  • lipid homeostasis
  • acetyl-CoA metabolic process
  • long-chain fatty-acyl-CoA biosynthetic process
  • malonyl-CoA biosynthetic process
  • energy reserve metabolic process
  • multicellular organismal protein metabolic process
  • biotin metabolic process
  • vitamin metabolic process
  • water-soluble vitamin metabolic process
  • protein homotetramerization
  • cellular lipid metabolic process
Components
  • cytoplasm
  • mitochondrion
  • actin cytoskeleton
  • cytosol
  • extracellular exosome
  • nucleolus
General FunctionMetal ion binding
Specific FunctionCatalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID849083
UniProtKB IDQ13085
UniProtKB Entry NameACACA_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0010436|Acetyl-CoA carboxylase 1 (ACACA)
ATGTGGTGGTCTACTCTGATGTCAATCTTGAGGGCTAGGTCTTTTTGGAAGTGGATATCT
ACTCAGACAGTAAGAATTATAAGAGCTGTAAGAGCTCATTTTGGAGGAATAATGGATGAA
CCATCTCCCTTGGCCCAACCTCTGGAGCTGAACCAGCACTCTCGATTCATAATAGGTTCT
GTGTCTGAAGATAACTCAGAGGATGAGATCAGCAACCTGGTGAAGTTGGACCTACTGGAG
GAGAAGGAGGGCTCCTTGTCACCTGCTTCTGTTGGCTCAGATACACTCTCTGATTTGGGG
ATCTCTAGCCTACAGGATGGCTTGGCCTTGCACATAAGGTCCAGCATGTCTGGCTTGCAC
CTAGTAAAGCAGGGCCGAGACAGAAAGAAAATAGATTCTCAACGAGATTTCACTGTGGCT
TCTCCAGCAGAATTTGTTACTCGCTTTGGGGGAAATAAAGTGATTGAGAAGGTTCTTATT
GCTAACAATGGCATTGCAGCAGTGAAATGCATGCGGTCTATCCGTAGGTGGTCTTATGAA
ATGTTTCGAAATGAACGTGCAATTAGATTCGTTGTCATGGTCACACCTGAAGACCTTAAA
GCCAATGCAGAATACATTAAGATGGCAGATCACTATGTGCCAGTGCCTGGAGGACCAAAC
AACAACAACTATGCAAATGTGGAATTAATTCTTGATATTGCTAAAAGGATCCCAGTACAA
GCAGTGTGGGCTGGCTGGGGTCATGCTTCTGAGAATCCCAAACTACCGGAACTTCTCTTG
AAAAATGGCATTGCCTTCATGGGTCCTCCAAGCCAGGCCATGTGGGCTTTAGGGGATAAG
ATTGCATCTTCCATAGTGGCTCAAACTGCAGGTATCCCAACTCTTCCCTGGAGCGGCAGT
GGTCTTCGTGTGGACTGGCAGGAAAATGATTTTTCAAAACGTATCTTAAATGTTCCCCAG
GAGCTATATGAAAAAGGTTATGTGAAAGATGTGGATGATGGGCTACAGGCAGCTGAGGAA
GTTGGATATCCAGTAATGATCAAGGCCTCAGAGGGAGGAGGAGGGAAGGGAATTAGAAAA
GTCAACAATGCAGATGACTTCCCTAATCTCTTCAGACAGGTTCAAGCTGAAGTTCCTGGA
TCTCCCATATTTGTGATGAGACTAGCCAAACAATCTCGTCATCTGGAGGTGCAGATCTTA
GCGGACCAATATGGCAATGCTATCTCTTTGTTTGGTCGTGATTGCTCTGTACAACGCAGG
CATCAGAAGATTATTGAAGAAGCACCTGCTACTATTGCTACTCCAGCAGTATTTGAACAC
ATGGAACAGTGTGCGGTGAAACTTGCCAAAATGGTGGGTTATGTGAGTGCTGGGACTGTG
GAATACCTGTACAGCCAGGATGGCAGCTTCTACTTTCTGGAATTGAATCCTCGGCTGCAG
GTAGAGCACCCTTGTACAGAGATGGTGGCTGATGTCAATCTCCCTGCAGCACAGCTCCAG
ATTGCCATGGGGATTCCTCTATATAGAATCAAGGATATCCGTATGATGTATGGGGTATCT
CCCTGGGGTGATTCTCCCATTGATTTTGAAGATTCTGCACACGTTCCTTGTCCAAGGGGC
CATGTTATTGCTGCTCGGATCACTAGTGAAAATCCAGATGAGGGTTTTAAGCCCAGCTCA
GGAACAGTTCAGGAGCTAAATTTCCGCAGCAATAAGAATGTTTGGGGATATTTCAGTGTT
GCTGCTGCAGGGGGACTTCATGAATTTGCTGATTCTCAGTTTGGTCACTGCTTTTCTTGG
GGAGAAAACAGAGAAGAGGCAATTTCAAACATGGTGGTGGCTTTGAAGGAGCTGTCTATT
CGGGGTGACTTTCGAACTACAGTTGAATACCTGATCAAATTGTTAGAGACTGAAAGCTTT
CAGATGAACAGAATTGATACTGGCTGGCTGGACAGACTGATAGCAGAAAAAGTACAGGCT
GAGCGACCTGACACCATGTTGGGGGTTGTGTGTGGTGCCCTCCACGTGGCAGATGTGAGC
CTGCGGAATAGCGTCTCTAACTTCCTTCACTCCTTAGAAAGGGGTCAAGTCCTTCCTGCT
CATACACTTCTGAATACAGTAGATGTTGAACTTATCTATGAGGGAGTCAAGTATGTACTT
AAGGTGACTCGACAGTCCCCCAACTCCTATGTGGTGATCATGAATGGCTCATGTGTAGAA
GTAGATGTACATCGGCTGAGTGACGGTGGACTGCTCTTGTCCTATGATGGCAGCAGTTAT
ACTACGTATATGAAAGAGGAAGTGGATAGATATCGCATCACAATTGGCAATAAAACCTGT
GTGTTTGAGAAGGAAAATGACCCATCGGTGATGCGCTCACCTTCTGCTGGGAAGTTAATC
CAGTACATTGTAGAAGATGGAGGTCATGTGTTTGCCGGCCAGTGCTATGCTGAGATTGAG
GTAATGAAGATGGTAATGACCTTAACAGCTGTGGAGTCTGGCTGTATCCATTACGTCAAG
CGACCTGGAGCAGCTCTTGACCCTGGCTGTGTACTAGCCAAAATGCAACTGGACAACCCC
AGCAAGGTTCAGCAGGCTGAACTTCACACAGGTAGTCTGCCACGGATCCAGAGCACGGCA
CTCAGAGGCGAGAAACTCCATCGAGTGTTCCATTATGTCCTGGATAATCTGGTCAATGTA
ATGAATGGATACTGCCTTCCAGATCCTTTCTTTAGCAGCAAGGTAAAAGACTGGGTAGAG
CGATTGATGAAAACCCTCAGAGATCCCTCCCTGCCTCTCCTAGAATTGCAAGATATTATG
ACCAGTGTGTCTGGCCGCATTCCCCCCAATGTGGAGAAGTCTATCAAGAAGGAAATGGCT
CAGTATGCTAGCAACATCACATCAGTCCTCTGTCAGTTTCCCAGCCAGCAGATTGCAAAC
ATCCTAGATAGCCATGCAGCTACATTGAACCGGAAATCTGAACGGGAAGTCTTCTTTATG
AATACTCAGAGCATTGTTCAGCTGGTACAGAGGTACCGAAGTGGCATCCGAGGCCACATG
AAGGCTGTGGTGATGGATCTGCTCCGGCAGTACCTGCGAGTAGAGACACAATTCCAGAAT
GGTCACTATGACAAATGTGTATTCGCCCTCCGAGAAGAGAATAAAAGTGACATGAACACT
GTACTGAACTACATCTTCTCTCACGCTCAAGTCACCAAGAAGAATCTTCTGGTCACAATG
CTTATTGATCAGTTGTGTGGCCGGGACCCTACTCTCACTGATGAGCTGCTGAATATTCTC
ACAGAGCTAACTCAACTCAGTAAGACCACCAATGCCAAAGTAGCACTTCGAGCACGCCAG
GTTCTTATTGCCTCCCATTTGCCATCATATGAGCTTCGCCATAACCAAGTAGAGTCTATC
TTCCTATCAGCTATTGACATGTATGGACATCAATTTTGCATTGAGAACCTGCAGAAACTC
ATCCTATCAGAAACATCTATTTTTGATGTCCTACCAAACTTCTTCTATCACAGCAACCAA
GTAGTGAGGATGGCAGCTCTGGAGGTGTATGTTCGAAGGGCTTATATTGCCTATGAACTT
AACAGCGTACAACACCGCCAGCTTAAGGACAACACCTGTGTGGTGGAATTCCAGTTCATG
CTGCCCACATCTCATCCAAACAGAGGGAACATCCCTACGCTAAACAGAATGTCCTTCTCC
TCCAACCTCAACCACTATGGCATGACCCATGTAGCTAGTGTCAGCGATGTACTGTTGGAC
AACTCATTCACTCCACCTTGTCAGCGGATGGGCGGAATGGTCTCTTTTCGGACTTTTGAA
GATTTTGTCAGGATCTTTGATGAAGTGATGGGCTGCTTCTCTGACTCCCCACCCCAGAGT
CCCACATTCCCTGAGGCAGGTCACACGTCTCTTTATGATGAGGATAAGGTTCCCAGGGAT
GAACCAATTCACATTCTCAATGTGGCTATCAAGACTGACTGTGATATTGAGGATGACAGG
CTGGCAGCTATGTTCAGAGAATTTACCCAGCAAAATAAAGCTACCCTGGTTGACCATGGG
ATCCGGCGCCTTACTTTCCTGGTTGCACAAAAGGATTTCAGAAAGCAGGTCAACTATGAG
GTGGATCGGAGATTTCATAGAGAATTCCCTAAATTTTTTACATTCCGAGCAAGGGATAAG
TTTGAGGAGGATCGTATCTATCGTCATCTGGAGCCTGCTCTGGCTTTCCAGTTAGAGCTG
AACCGGATGAGAAATTTTGACCTCACTGCCATTCCATGTGCTAATCACAAGATGCACCTG
TATCTCGGGGCAGCCAAGGTGGAAGTGGGCACAGAAGTGACAGACTACAGGTTCTTTGTT
CGTGCAATCATCAGGCATTCTGATCTGGTCACCAAGGAAGCTTCTTTTGAATATCTGCAA
AATGAAGGGGAGCGGCTACTCCTGGAAGCCATGGATGAGTTGGAAGTTGCTTTTAACAAT
ACAAATGTCCGCACTGACTGTAACCACATCTTCCTCAACTTTGTGCCCACGGTTATCATG
GACCCATCAAAGATTGAGGAATCCGTGCGGAGCATGGTAATGCGGTATGGAAGTCGCCTG
TGGAAATTGCGCGTCCTCCAGGCAGAACTGAAAATCAACATTCGCCTGACGCCAACTGGA
AAAGCAATTCCCATCCGCCTCTTCCTGACAAACGAGTCTGGCTATTACTTGGATATCAGC
CTATACAAGGAAGTGACTGACTCCAGGACAGCACAGATCATGTTTCAGGCATATGGAGAC
AAACAGGGACCACTGCATGGAATGTTAATCAATACTCCATATGTGACCAAAGACCTGCTG
CAATCAAAGAGGTTCCAGGCACAATCCTTAGGGACAACATACATATATGATATCCCAGAG
ATGTTTCGGCAGTCCCTGATCAAACTCTGGGAGTCTATGTCCACTCAAGCATTTCTTCCA
TCTCCCCCTCTGCCTTCTGACATGCTGACTTACACTGAACTGGTACTGGATGATCAAGGT
CAGCTGGTCCACATGAACAGGCTTCCAGGAGGAAATGAGATTGGCATGGTAGCTTGGAAA
ATGACCTTTAAAAGTCCTGAATATCCAGAAGGCCGAGATATCATTGTTATTGGCAATGAC
ATCACATACCGAATTGGGTCCTTTGGGCCTCAAGAGGATTTGTTATTTCTCAGAGCTTCC
GAACTTGCTAGGGCAGAAGGTATTCCACGCATCTATGTATCAGCCAACAGTGGAGCAAGA
ATCGGACTGGCAGAAGAAATTCGCCATATGTTTCATGTGGCCTGGGTAGATCCTGAGGAT
CCTTACAAGGGATACAGGTATTTATATCTGACTCCTCAAGATTATAAGAGAGTCAGTGCT
CTCAACTCTGTCCATTGTGAACACGTGGAAGATGAAGGAGAATCCAGGTACAAGATAACA
GATATTATTGGGAAAGAAGAGGGAATTGGACCCGAGAACCTTCGAGGTTCTGGAATGATT
GCTGGAGAATCCTCATTGGCCTATAATGAGATCATTACCATCAGCCTGGTGACGTGCCGG
GCCATTGGGATTGGGGCTTACCTTGTCCGGCTGGGACAGAGAACCATCCAGGTTGAGAAT
TCTCACTTAATTCTAACAGGAGCTGGAGCCCTCAACAAAGTCCTCGGGCGGGAAGTGTAC
ACCTCCAATAACCAGCTGGGGGGCATCCAGATTATGCACAACAATGGGGTGACCCACTGC
ACTGTGTGTGATGACTTTGAAGGGGTTTTCACTGTCCTGCACTGGCTGTCTTACATGCCC
AAGAGCGTGCACAGTTCAGTTCCTCTTCTGAACTCAAAGGATCCTATAGACAGAATCATC
GAGTTTGTTCCCACAAAGACCCCATACGATCCTCGATGGATGCTAGCAGGCCGTCCTCAC
CCAACCCAAAAAGGTCAGTGGTTGAGTGGCTTTTTTGACTATGGATCTTTCTCAGAGATT
ATGCAGCCCTGGGCACAGACTGTGGTGGTTGGTAGAGCCAGGCTAGGAGGAATACCTGTG
GGAGTTGTTGCTGTAGAAACCCGAACAGTAGAACTAAGTATCCCAGCTGATCCAGCAAAC
CTGGATTCTGAAGCCAAGATAATCCAGCAGGCTGGCCAGGTTTGGTTCCCAGATTCTGCG
TTTAAGACGTATCAGGCCATCAAGGACTTCAACCGGGAAGGGCTGCCTCTGATGGTCTTT
GCCAACTGGAGAGGCTTCTCTGGTGGAATGAAAGATATGTACGACCAAGTGCTGAAGTTT
GGTGCTTACATTGTGGATGGCTTGAGGGAGTGCTGCCAGCCTGTGCTGGTTTACATTCCT
CCCCAGGCTGAGCTGCGGGGTGGCTCCTGGGTGGTGATTGACTCCTCCATCAACCCCCGG
CACATGGAGATGTATGCTGACCGAGAAAGCAGGGGATCTGTTCTGGAGCCAGAAGGGACA
GTAGAAATCAAATTCCGCAGAAAGGATCTGGTGAAAACCATGCGTCGGGTGGACCCAGTC
TACATCCACTTGGCTGAGCGATTGGGGACCCCAGAGCTAAGCACAGCTGAGCGGAAGGAG
TTGGAGAACAAGTTGAAGGAGCGGGAGGAATTCCTAATTCCCATTTACCATCAGGTAGCC
GTGCAGTTTGCTGACTTGCACGACACACCAGGCCGGATGCAGGAGAAGGGTGTTATTAGC
GATATCCTGGATTGGAAAACATCCCGTACCTTCTTCTACTGGCGGCTGAGGCGTCTTCTG
CTGGAGGACCTGGTCAAGAAGAAAATCCACAATGCCAACCCTGAGCTGACTGATGGCCAG
ATTCAAGCCATGTTAAGGCGCTGGTTTGTGGAAGTGGAAGGAACAGTGAAGGCTTATGTT
TGGGACAATAATAAGGATCTGGCGGAGTGGCTAGAGAAACAGCTGACAGAGGAGGATGGT
GTTCACTCGGTAATAGAGGAAAACATCAAATGCATCAGCAGAGACTACGTCCTCAAGCAA
ATCCGCAGCTTGGTCCAGGCCAATCCAGAGGTTGCCATGGATTCCATCATCCATATGACG
CAGCACATATCACCCACTCAGCGAGCAGAAGTCATACGGATCCTCTCCACAATGGATTCC
CCTTCCACGTAG
GenBank Gene IDU19822
GeneCard IDNot Available
GenAtlas IDACACA
HGNC IDHGNC:84
Chromosome Location17
Locus17q21
References
  1. Abu-Elheiga L, Jayakumar A, Baldini A, Chirala SS, Wakil SJ: Human acetyl-CoA carboxylase: characterization, molecular cloning, and evidence for two isoforms. Proc Natl Acad Sci U S A. 1995 Apr 25;92(9):4011-5. 7732023
  2. Mao J, Chirala SS, Wakil SJ: Human acetyl-CoA carboxylase 1 gene: presence of three promoters and heterogeneity at the 5'-untranslated mRNA region. Proc Natl Acad Sci U S A. 2003 Jun 24;100(13):7515-20. Epub 2003 Jun 16. 12810950
  3. Sinilnikova OM, Ginolhac SM, Magnard C, Leone M, Anczukow O, Hughes D, Moreau K, Thompson D, Coutanson C, Hall J, Romestaing P, Gerard JP, Bonadona V, Lasset C, Goldgar DE, Joulin V, Venezia ND, Lenoir GM: Acetyl-CoA carboxylase alpha gene and breast cancer susceptibility. Carcinogenesis. 2004 Dec;25(12):2417-24. Epub 2004 Aug 27. 15333468
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Travers MT, Vallance AJ, Clegg RA, Thomson R, Price NT, Barber MC: Characterisation of an N-terminal variant of acetyl-CoA carboxylase-alpha: expression in human tissues and evolutionary aspects. Biochim Biophys Acta. 2003 Nov 15;1634(3):97-106. 14643797
  6. Travers MT, Cambot M, Kennedy HT, Lenoir GM, Barber MC, Joulin V: Asymmetric expression of transcripts derived from the shared promoter between the divergently oriented ACACA and TADA2L genes. Genomics. 2005 Jan;85(1):71-84. 15607423
  7. Magnard C, Bachelier R, Vincent A, Jaquinod M, Kieffer S, Lenoir GM, Venezia ND: BRCA1 interacts with acetyl-CoA carboxylase through its tandem of BRCT domains. Oncogene. 2002 Oct 3;21(44):6729-39. 12360400
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  9. Moreau K, Dizin E, Ray H, Luquain C, Lefai E, Foufelle F, Billaud M, Lenoir GM, Venezia ND: BRCA1 affects lipid synthesis through its interaction with acetyl-CoA carboxylase. J Biol Chem. 2006 Feb 10;281(6):3172-81. Epub 2005 Dec 2. 16326698
  10. Ray H, Moreau K, Dizin E, Callebaut I, Venezia ND: ACCA phosphopeptide recognition by the BRCT repeats of BRCA1. J Mol Biol. 2006 Jun 16;359(4):973-82. Epub 2006 Apr 25. 16698035
  11. Blom W, de Muinck Keizer SM, Scholte HR: Acetyl-CoA carboxylase deficiency: an inborn error of de novo fatty acid synthesis. N Engl J Med. 1981 Aug 20;305(8):465-6. 6114432
  12. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. 18220336
  13. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  14. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  15. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  16. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  17. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  18. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  19. Colbert CL, Kim CW, Moon YA, Henry L, Palnitkar M, McKean WB, Fitzgerald K, Deisenhofer J, Horton JD, Kwon HJ: Crystal structure of Spot 14, a modulator of fatty acid synthesis. Proc Natl Acad Sci U S A. 2010 Nov 2;107(44):18820-5. doi: 10.1073/pnas.1012736107. Epub 2010 Oct 15. 20952656
  20. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  21. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  22. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  24. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974