You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMetabotropic glutamate receptor 1
Synonyms
  • GPRC1A
  • MGLUR1
Gene NameGRM1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037086|Metabotropic glutamate receptor 1
MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGG
GQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
EDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQ
QQPPPQQKSLMDQLQGVVSNFSTAIPDFHAVLAGPGGPGNGLRSLYPPPPPPQHLQMLPL
QLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELEEEEEDLQAASKLTPD
DSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL
Number of residues1194
Molecular Weight132355.855
Theoretical pI6.67
GO Classification
Functions
  • G-protein coupled receptor activity
  • glutamate receptor activity
Processes
  • regulation of sensory perception of pain
  • regulation of synaptic transmission, glutamatergic
  • synaptic transmission
  • cellular response to electrical stimulus
  • dimeric G-protein coupled receptor signaling pathway
  • G-protein coupled glutamate receptor signaling pathway
  • activation of MAPKK activity
  • G-protein coupled receptor signaling pathway
  • protein kinase C-activating G-protein coupled receptor signaling pathway
  • positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
  • locomotory behavior
  • sensory perception of pain
  • activation of MAPK activity
Components
  • nucleus
  • G-protein coupled receptor dimeric complex
  • plasma membrane
  • G-protein coupled receptor homodimeric complex
  • cytosol
  • integral component of plasma membrane
  • dendrite
  • postsynaptic density
General FunctionGlutamate receptor activity
Specific FunctionG-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system. May participate in the central action of glutamate in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum.
Pfam Domain Function
Transmembrane Regions593-615 630-650 659-680 704-727 751-772 786-807 816-840
GenBank Protein ID945097
UniProtKB IDQ13255
UniProtKB Entry NameGRM1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010582|Metabotropic glutamate receptor 1 (GRM1)
ATGGTCGGGCTCCTTTTGTTTTTTTTCCCAGCGATCTTTTTGGAGGTGTCCCTTCTCCCC
AGAAGCCCCGGCAGGAAAGTGTTGCTGGCAGGAGCGTCGTCTCAGCGCTCGGTGGCCAGA
ATGGACGGAGATGTCATCATTGGAGCCCTCTTCTCAGTCCATCACCAGCCTCCGGCCGAG
AAAGTGCCCGAGAGGAAGTGTGGGGAGATCAGGGAGCAGTATGGCATCCAGAGGGTGGAG
GCCATGTTCCACACGTTGGATAAGATCAACGCGGACCCGGTCCTCCTGCCCAACATCACC
CTGGGCAGTGAGATCCGGGACTCCTGCTGGCACTCTTCCGTGGCTCTGGAACAGAGCATT
GAGTTCATTAGGGACTCTCTGATTTCCATTCGAGATGAGAAGGATGGGATCAACCGGTGT
CTGCCTGACGGCCAGTCCCTCCCCCCAGGCAGGACTAAGAAGCCCATTGCGGGAGTGATC
GGTCCCGGCTCCAGCTCTGTAGCCATTCAAGTGCAGAACCTGCTCCAGCTCTTCGACATC
CCCCAGATCGCTTATTCAGCCACAAGCATCGACCTGAGTGACAAAACTTTGTACAAATAC
TTCCTGAGGGTTGTCCCTTCTGACACTTTGCAGGCAAGGGCCATGCTTGACATAGTCAAA
CGTTACAATTGGACCTATGTCTCTGCAGTCCACACGGAAGGGAATTATGGGGAGAGCGGA
ATGGACGCTTTCAAAGAGCTGGCTGCCCAGGAAGGCCTCTGTATCGCCCATTCTGACAAA
ATCTACAGCAACGCTGGGGAGAAGAGCTTTGACCGACTCTTGCGCAAACTCCGAGAGAGG
CTTCCCAAGGCTAGAGTGGTGGTCTGCTTCTGTGAAGGCATGACAGTGCGAGGACTCCTG
AGCGCCATGCGGCGCCTTGGCGTCGTGGGCGAGTTCTCACTCATTGGAAGTGATGGATGG
GCAGACAGAGATGAAGTCATTGAAGGTTATGAGGTGGAAGCCAACGGGGGAATCACGATA
AAGCTGCAGTCTCCAGAGGTCAGGTCATTTGATGATTATTTCCTGAAACTGAGGCTGGAC
ACTAACACGAGGAATCCCTGGTTCCCTGAGTTCTGGCAACATCGGTTCCAGTGCCGCCTT
CCAGGACACCTTCTGGAAAATCCCAACTTTAAACGAATCTGCACAGGCAATGAAAGCTTA
GAAGAAAACTATGTCCAGGACAGTAAGATGGGGTTTGTCATCAATGCCATCTATGCCATG
GCACATGGGCTGCAGAACATGCACCATGCCCTCTGCCCTGGCCACGTGGGCCTCTGCGAT
GCCATGAAGCCCATCGACGGCAGCAAGCTGCTGGACTTCCTCATCAAGTCCTCATTCATT
GGAGTATCTGGAGAGGAGGTGTGGTTTGATGAGAAAGGAGACGCTCCTGGAAGGTATGAT
ATCATGAATCTGCAGTACACTGAAGCTAATCGCTATGACTATGTGCACGTTGGAACCTGG
CATGAAGGAGTGCTGAACATTGATGATTACAAAATCCAGATGAACAAGAGTGGAGTGGTG
CGGTCTGTGTGCAGTGAGCCTTGCTTAAAGGGCCAGATTAAGGTTATACGGAAAGGAGAA
GTGAGCTGCTGCTGGATTTGCACGGCCTGCAAAGAGAATGAATATGTGCAAGATGAGTTC
ACCTGCAAAGCTTGTGACTTGGGATGGTGGCCCAATGCAGATCTAACAGGCTGTGAGCCC
ATTCCTGTGCGCTATCTTGAGTGGAGCAACATCGAATCCATTATAGCCATCGCCTTTTCA
TGCCTGGGAATCCTTGTTACCTTGTTTGTCACCCTAATCTTTGTACTGTACCGGGACACA
CCAGTGGTCAAATCCTCCAGTCGGGAGCTCTGCTACATCATCCTAGCTGGCATCTTCCTT
GGTTATGTGTGCCCATTCACTCTCATTGCCAAACCTACTACCACCTCCTGCTACCTCCAG
CGCCTCTTGGTTGGCCTCTCCTCTGCGATGTGCTACTCTGCTTTAGTGACTAAAACCAAT
CGTATTGCACGCATCCTGGCTGGCAGCAAGAAGAAGATCTGCACCCGGAAGCCCAGGTTC
ATGAGTGCCTGGGCTCAGGTGATCATTGCCTCAATTCTGATTAGTGTGCAACTAACCCTG
GTGGTAACCCTGATCATCATGGAACCCCCTATGCCCATTCTGTCCTACCCAAGTATCAAG
GAAGTCTACCTTATCTGCAATACCAGCAACCTGGGTGTGGTGGCCCCTTTGGGCTACAAT
GGACTCCTCATCATGAGCTGTACCTACTATGCCTTCAAGACCCGCAACGTGCCCGCCAAC
TTCAACGAGGCCAAATATATCGCGTTCACCATGTACACCACCTGTATCATCTGGCTAGCT
TTTGTGCCCATTTACTTTGGGAGCAACTACAAGATCATCACAACTTGCTTTGCAGTGAGT
CTCAGTGTAACAGTGGCTCTGGGGTGCATGTTCACTCCCAAGATGTACATCATTATTGCC
AAGCCTGAGAGGAATGTCCGCAGTGCCTTCACCACCTCTGATGTTGTCCGCATGCATGTT
GGCGATGGCAAGCTGCCCTGCCGCTCCAACACTTTCCTCAACATCTTCCGAAGAAAGAAG
GCAGGGGCAGGGAATGCCAATTCTAATGGCAAGTCTGTGTCATGGTCTGAACCAGGTGGA
GGACAGGTGCCCAAGGGACAGCATATGTGGCACCGCCTCTCTGTGCACGTGAAGACCAAT
GAGACGGCCTGCAACCAAACAGCCGTCATCAAGCCCCTCACTAAAAGTTACCAAGGCTCT
GGCAAGAGCCTGACCTTTTCAGATACCAGCACCAAGACCCTTTACAACGTAGAGGAGGAG
GAGGATGCCCAGCCGATTCGCTTTAGCCCGCCTGGTAGCCCTTCCATGGTGGTGCACAGG
CGCGTGCCAAGCGCGGCGACCACTCCGCCTCTGCCGTCCCACCTGACCGCAGAGGAGACC
CCCCTCTTCCTGGCCGAACCAGCCCTCCCCAAGGGCTTGCCCCCTCCTCTCCAGCAGCAG
CAGCAACCCCCTCCACAGCAGAAATCGCTGATGGACCAGCTCCAGGGAGTGGTCAGCAAC
TTCAGTACCGCGATCCCGGATTTTCACGCGGTGCTGGCAGGCCCCGGTGGTCCCGGGAAC
GGGCTGCGGTCCCTGTACCCGCCCCCGCCACCTCCGCAGCACCTGCAGATGCTGCCGCTG
CAGCTGAGCACCTTTGGGGAGGAGCTGGTCTCCCCGCCCGCGGACGACGACGACGACAGC
GAGAGGTTTAAGCTCCTCCAGGAGTACGTGTATGAGCACGAGCGGGAAGGGAACACGGAA
GAAGACGAACTGGAAGAGGAGGAGGAGGACCTGCAGGCGGCCAGCAAACTGACCCCGGAT
GATTCGCCTGCGCTGACGCCTCCGTCGCCTTTCCGCGACTCGGTGGCCTCGGGCAGCTCG
GTGCCCAGCTCCCCCGTGTCCGAGTCGGTGCTCTGCACCCCTCCCAACGTATCCTACGCC
TCTGTCATTCTGCGGGACTACAAGCAAAGCTCTTCCACCCTGTAA
GenBank Gene IDU31215
GeneCard IDNot Available
GenAtlas IDGRM1
HGNC IDHGNC:4593
Chromosome Location6
Locus6q24
References
  1. Desai MA, Burnett JP, Mayne NG, Schoepp DD: Cloning and expression of a human metabotropic glutamate receptor 1 alpha: enhanced coupling on co-transfection with a glutamate transporter. Mol Pharmacol. 1995 Oct;48(4):648-57. 7476890
  2. Stephan D, Bon C, Holzwarth JA, Galvan M, Pruss RM: Human metabotropic glutamate receptor 1: mRNA distribution, chromosome localization and functional expression of two splice variants. Neuropharmacology. 1996;35(12):1649-60. 9076744
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. 14574404
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Guergueltcheva V, Azmanov DN, Angelicheva D, Smith KR, Chamova T, Florez L, Bynevelt M, Nguyen T, Cherninkova S, Bojinova V, Kaprelyan A, Angelova L, Morar B, Chandler D, Kaneva R, Bahlo M, Tournev I, Kalaydjieva L: Autosomal-recessive congenital cerebellar ataxia is caused by mutations in metabotropic glutamate receptor 1. Am J Hum Genet. 2012 Sep 7;91(3):553-64. doi: 10.1016/j.ajhg.2012.07.019. Epub 2012 Aug 16. 22901947
  6. Wu H, Wang C, Gregory KJ, Han GW, Cho HP, Xia Y, Niswender CM, Katritch V, Meiler J, Cherezov V, Conn PJ, Stevens RC: Structure of a class C GPCR metabotropic glutamate receptor 1 bound to an allosteric modulator. Science. 2014 Apr 4;344(6179):58-64. doi: 10.1126/science.1249489. Epub 2014 Mar 6. 24603153
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974