You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase S
Synonyms
  • 3.1.3.48
  • R-PTP-S
  • R-PTP-sigma
  • Receptor-type tyrosine-protein phosphatase sigma
Gene NamePTPRS
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037247|Receptor-type tyrosine-protein phosphatase S
MAPTWGPGMVSVVGPMGLLVVLLVGGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHA
KLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREV
RRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLEL
TDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPV
SYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTR
TGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV
DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETS
ITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQ
GLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRP
LGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVP
SAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLA
DAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSV
QQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHKGAT
YVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNG
AIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGP
FSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDVDGR
TTKKLITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFNLLNGKPSVAPKPDADGFIMV
YLPDGQSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEELIQDISRLQRRSLRHSR
QLEVPRPYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAAS
PFSDPFQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPR
TKCLLNNADLAPHHPKDPVEMRRINFQTPDSGLRSPLREPGFHFESMLSHPPIPIADMAE
HTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG
IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIK
CDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGV
PEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGH
VTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGM
ELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASF
IDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSA
RYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFI
GQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRP
AMVQTEDEYQFCYQAALEYLGSFDHYAT
Number of residues1948
Molecular Weight217039.825
Theoretical pI6.46
GO Classification
Functions
  • transmembrane receptor protein tyrosine phosphatase activity
Processes
  • extracellular matrix organization
  • spinal cord development
  • hippocampus development
  • cerebellum development
  • cerebral cortex development
  • corpus callosum development
  • establishment of endothelial intestinal barrier
  • cell adhesion
Components
  • extracellular exosome
  • integral component of plasma membrane
General FunctionTransmembrane receptor protein tyrosine phosphatase activity
Specific FunctionInteracts with LAR-interacting protein LIP.1.
Pfam Domain Function
Transmembrane Regions1283-1303
GenBank Protein ID1109792
UniProtKB IDQ13332
UniProtKB Entry NamePTPRS_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0019440|Receptor-type tyrosine-protein phosphatase S (PTPRS)
ATGGCGCCCACCTGGGGCCCTGGCATGGTGTCTGTGGTTGGTCCCATGGGCCTCCTTGTG
GTCCTGCTCGTTGGAGGCTGTGCAGCAGAAGAGCCCCCCAGGTTTATCAAAGAACCCAAG
GACCAGATCGGCGTGTCGGGGGGTGTGGCCTCTTTCGTGTGTCAGGCCACGGGTGACCCC
AAGCCACGAGTGACCTGGAACAAGAAGGGCAAGAAGGTCAACTCTCAGCGCTTTGAGACG
ATTGAGTTTGATGAGAGTGCAGGGGCAGTGCTGAGGATCCAGCCGCTGAGGACACCGCGG
GATGAAAACGTGTACGAGTGTGTGGCCCAGAACTCGGTTGGGGAGATCACAGTCCATGCC
AAGCTTACTGTCCTCCGAGAGGACCAGCTGCCCTCTGGCTTCCCCAACATCGACATGGGC
CCACAGTTGAAGGTGGTGGAGCGGACACGGACAGCCACCATGCTCTGTGCAGCCAGCGGC
AACCCTGACCCTGAGATCACCTGGTTCAAGGACTTCCTGCCTGTGGATCCTAGTGCCAGC
AATGGACGCATCAAACAGCTGCGATCAGAAACCTTTGAAAGCACTCCGATTCGAGGAGCC
CTGCAGATTGAAAGCAGTGAGGAAACCGACCAGGGCAAATATGAGTGTGTGGCCACCAAC
AGCGCCGGCGTGCGCTACTCCTCACCTGCCAACCTCTACGTGCGAGAGCTTCGAGAAGTC
CGCCGCGTGGCCCCGCGCTTCTCCATCCTGCCCATGAGCCACGAGATCATGCCAGGGGGC
AACGTGAACATCACCTGCGTGGCCGTGGGCTCGCCCATGCCATACGTGAAGTGGATGCAG
GGGGCCGAGGACCTGACCCCCGAGGATGACATGCCCGTGGGTCGGAACGTGCTGGAACTC
ACAGATGTCAAGGACTCGGCCAACTACACCTGCGTGGCCATGTCCAGCCTGGGCGTCATT
GAGGCGGTTGCTCAGATCACGGTGAAATCTCTCCCCAAAGCTCCCGGGACTCCCATGGTG
ACTGAGAACACAGCCACCAGCATCACCATCACGTGGGACTCGGGCAACCCAGATCCTGTG
TCCTATTACGTCATCGAATATAAATCCAAGAGCCAAGACGGGCCGTATCAGATTAAAGAG
GACATCACCACCACACGTTACAGCATCGGCGGCCTGAGCCCCAACTCGGAGTACGAGATC
TGGGTGTCGGCCGTCAACTCCATCGGCCAGGGGCCCCCCAGCGAGTCCGTGGTCACCCGC
ACAGGCGAGCAGGCCCCGGCCAGCGCGCCGCGGAACGTGCAAGCCCGGATGCTCAGCGCG
ACCACCATGATTGTGCAGTGGGAGGAGCCGGTGGAGCCCAACGGCCTGATCCGCGGCTAC
CGCGTCTACTACACCATGGAACCGGAGCACCCCGTGGGCAACTGGCAGAAGCACAACGTG
GACGACAGCCTGCTGACCACCGTGGGCAGCCTGCTGGAGGACGAGACCTACACCGTGCGG
GTGCTCGCCTTCACCTCCGTCGGCGACGGGCCCCTCTCGGACCCCATCCAGGTCAAGACG
CAGCAGGGAGTGCCGGGCCAGCCCATGAACCTGCGGGCCGAGGCCAGGTCGGAGACCAGC
ATCACGCTGTCCTGGAGCCCCCCGCGGCAGGAGAGTATCATCAAGTACGAGCTCCTCTTC
CGGGAAGGCGACCATGGCCGGGAGGTGGGAAGGACCTTCGACCCGACGACTTCCTACGTG
GTGGAGGACCTGAAGCCCAACACGGAGTACGCCTTCCGCCTGGCGGCCCGCTCGCCGCAG
GGCCTGGGCGCCTTCACCCCCGTGGTGCGGCAGCGCACGCTGCAGTCCAAACCGTCAGCC
CCCCCTCAAGACGTTAAATGTGTCAGCGTGCGCTCCACGGCCATTTTGGTAAGTTGGCGC
CCGCCGCCGCCGGAAACGCACAACGGGGCCCTGGTGGGCTACAGCGTCCGCTACCGACCG
CTGGGCTCAGAGGACCCGGAACCCAAGGAGGTGAACGGCATCCCCCCGACCACCACTCAG
ATCCTGCTGGAGGCCTTGGAGAAGTGGACCCAGTACCGCATCACGACTGTCGCTCACACA
GAGGTGGGACCAGGGCCCGAGAGCTCGCCCGTGGTCGTCCGCACCGACGAGGATGTGCCC
AGCGCGCCGCCGCGGAAGGTGGAGGCGGAGGCGCTCAACGCCACGGCCATCCGCGTGCTG
TGGCGCTCGCCCGCGCCCGGCCGGCAGCACGGCCAGATCCGCGGCTACCAGGTCCACTAC
GTGCGCATGGAGGGCGCCGAGGCCCGCGGGCCGCCGCGCATCAAGGACGTCATGCTGGCC
GATGCCCAGTGGGAGACGGATGACACGGCCGAATATGAGATGGTCATCACAAACTTGCAG
CCTGAGACCGCGTACTCCATCACGGTAGCCGCCTACACCATGAAGGGCGATGGCGCTCGC
AGCAAACCCAAGGTGGTTGTGACCAAGGGAGCAGTGCTGGGCCGCCCAACCCTGTCGGTG
CAGCAGACCCCCGAGGGCAGCCTGCTGGCACGCTGGGAGCCCCCGGCTGGCACCGCGGAG
GACCAGGTGCTGGGCTACCGCCTGCAGTTTGGCCGTGAGGACTCGACGCCCCTGGCCACC
CTGGAGTTCCCGCCCTCCGAGGACCGCTACACGGCATCAGGCGTGCACAAGGGGGCCACG
TATGTGTTCCGGCTTGCGGCCCGGAGCCGCGGCGGCCTGGGCGAGGAGGCAGCCGAGGTC
CTGAGCATCCCGGAGGACACGCCCCGTGGCCACCCGCAGATTCTGGAGGCGGCCGGCAAC
GCCTCGGCCGGGACCGTCCTTCTCCGCTGGCTGCCACCCGTGCCCGCCGAGCGCAACGGG
GCCATCGTCAAATACACGGTGGCCGTGCGGGAGGCCGGTGCCCTGGGCCCTGCCCGAGAG
ACTGAGCTGCCGGCAGCGGCTGAGCCGGGCGCGGAGAACGCGCTCACGCTGCAGGGCCTG
AAGCCCGACACGGCCTATGACCTCCAAGTGCGAGCCCACACGCGCCGGGGCCCTGGCCCC
TTCAGCCCCCCCGTCCGCTACCGGACGTTCCTGCGGGACCAAGTCTCGCCCAAGAACTTC
AAGGTGAAAATGATCATGAAGACATCAGTTCTGCTCAGCTGGGAGTTCCCTGACAACTAC
AACTCACCCACACCCTACAAGATCCAGTACAATGGGCTCACACTGGATGTGGATGGCCGT
ACCACCAAGAAGCTCATCACGCACCTCAAGCCCCACACCTTCTACAACTTTGTGCTGACC
AATCGCGGCAGCAGCCTGGGCGGCCTCCAGCAGACGGTCACCGCCTGGACTGCCTTCAAC
CTGCTCAACGGCAAGCCCAGCGTCGCCCCCAAGCCTGATGCTGACGGCTTCATCATGGTG
TATCTTCCTGACGGCCAGAGCCCCGTGCCTGTCCAGAGCTATTTCATTGTGATGGTGCCA
CTGCGCAAGTCTCGTGGAGGCCAATTCCTGACCCCGCTGGGTAGCCCAGAGGACATGGAT
CTGGAAGAGCTCATCCAGGACATCTCACGGCTACAGAGGCGCAGCCTGCGGCACTCGCGT
CAGCTGGAGGTGCCCCGGCCCTATATTGCAGCTCGCTTCTCTGTGCTGCCACCCACGTTC
CATCCCGGCGACCAGAAGCAGTATGGCGGCTTCGATAACCGGGGCCTGGAGCCCGGCCAC
CGCTATGTCCTCTTCGTGCTTGCCGTGCTTCAGAAGAGCGAGCCTACCTTTGCAGCCAGT
CCCTTCTCAGACCCCTTCCAGCTGGATAACCCGGACCCCCAGCCCATCGTGGATGGCGAG
GAGGGGCTTATCTGGGTGATCGGGCCTGTGCTGGCCGTGGTCTTCATAATCTGCATTGTC
ATTGCTATCCTGCTCTACAAGAACAAACCCGACAGTAAACGCAAGGACTCAGAACCCCGC
ACCAAATGCCTCCTGAACAATGCCGACCTCGCCCCTCACCACCCCAAGGACCCTGTGGAA
ATGAGACGCATTAACTTCCAGACTCCAGATTCAGGCCTCAGGAGCCCCCTCAGGGAGCCG
GGGTTTCACTTTGAAAGCATGCTTAGCCACCCGCCAATTCCCATCGCAGACATGGCGGAG
CACACGGAGCGGCTCAAGGCCAACGACAGCCTCAAGCTCTCCCAGGAGTATGAGTCCATC
GACCCTGGACAGCAGTTCACATGGGAACATTCCAACCTGGAAGTGAACAAGCCGAAGAAC
CGCTATGCCAACGTCATCGCCTATGACCACTCCCGTGTCATCCTCCAGCCCATTGAAGGC
ATCATGGGCAGTGATTACATCAATGCCAACTACGTGGACGGCTACCGGTGTCAGAACGCG
TACATTGCCACGCAGGGGCCGCTGCCTGAGACCTTTGGGGACTTCTGGCGTATGGTGTGG
GAGCAGCGGTCGGCGACCATCGTCATGATGACGCGGCTGGAGGAGAAGTCACGGATCAAG
TGTGATCAGTATTGGCCCAACAGAGGCACGGAGACCTACGGCTTCATCCAGGTCACGTTG
CTAGATACCATCGAGCTGGCCACATTCTGCGTCAGGACATTCTCTCTGCACAAGAATGGC
TCCAGTGAGAAACGCGAGGTCCGCCAGTTCCAGTTTACGGCGTGGCCGGACCATGGCGTG
CCCGAATACCCAACGCCCTTCCTGGCTTTCCTGCGGAGAGTCAAGACCTGCAACCCGCCA
GATGCCGGCCCCATCGTGGTTCACTGCAGTGCCGGTGTGGGCCGCACAGGCTGCTTTATC
GTCATCGACGCCATGCTTGAGCGGATCAAGCCAGAGAAGACAGTCGATGTCTATGGCCAC
GTGACGCTCATGAGGTCCCAGCGCAACTACATGGTGCAGACGGAGGACCAGTACAGCTTC
ATCCACGAGGCCCTGCTGGAGGCCGTGGGCTGTGGCAACACAGAAGTGCCCGCACGCAGC
CTCTATGCCTACATCCAGAAGCTGGCCCAGGTGGAGCCTGGCGAACACGTCACTGGCATG
GAACTCGAGTTCAAGCGGCTGGCTAACTCCAAGGCCCACACGTCACGCTTCATCAGTGCC
AATCTGCCTTGTAACAAGTTCAAGAACCGCCTGGTGAACATCATGCCCTATGAGAGCACA
CGGGTCTGTCTGCAACCCATCCGGGGTGTGGAGGGCTCTGACTACATCAACGCCAGCTTC
ATTGATGGCTACAGGCAGCAGAAGGCCTACATCGCGACACAGGGGCCGCTGGCGGAGACC
ACGGAAGACTTCTGGCGCATGCTGTGGGAGAACAATTCGACGATCGTGGTGATGCTGACC
AAGCTGCGGGAGATGGGCCGGGAGAAGTGTCACCAGTACTGGCCGGCCGAGCGCTCTGCC
CGCTACCAGTACTTTGTGGTAGATCCGATGGCAGAATACAACATGCCTCAGTATATCCTG
CGAGAGTTCAAGGTCACAGATGCCCGGGATGGCCAGTCCCGGACTGTCCGGCAGTTCCAG
TTCACAGACTGGCCGGAACAGGGTGTGCCAAAGTCGGGGGAGGGCTTCATCGACTTCATT
GGCCAAGTGCATAAGACTAAGGAGCAGTTTGGCCAGGACGGCCCCATCTCTGTCCACTGC
AGTGCCGGCGTGGGCAGGACGGGCGTCTTCATCACGCTTAGCATCGTGCTGGAGCGGATG
CGGTATGAAGGCGTGGTGGACATCTTTCAGACGGTGAAGATGCTACGAACCCAGCGGCCG
GCCATGGTGCAGACAGAGGATGAGTACCAGTTCTGTTACCAGGCGGCACTGGAGTACCTC
GGAAGCTTTGACCACTATGCAACCTAA
GenBank Gene IDU35234
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9681
Chromosome Location19
Locus19p13.3
References
  1. Pulido R, Serra-Pages C, Tang M, Streuli M: The LAR/PTP delta/PTP sigma subfamily of transmembrane protein-tyrosine-phosphatases: multiple human LAR, PTP delta, and PTP sigma isoforms are expressed in a tissue-specific manner and associate with the LAR-interacting protein LIP.1. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11686-90. 8524829
  2. Endo N, Rutledge SJ, Opas EE, Vogel R, Rodan GA, Schmidt A: Human protein tyrosine phosphatase-sigma: alternative splicing and inhibition by bisphosphonates. J Bone Miner Res. 1996 Apr;11(4):535-43. 8992885
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Adachi M, Sekiya M, Arimura Y, Takekawa M, Itoh F, Hinoda Y, Imai K, Yachi A: Protein-tyrosine phosphatase expression in pre-B cell NALM-6. Cancer Res. 1992 Feb 1;52(3):737-40. 1370651
  6. Serra-Pages C, Medley QG, Tang M, Hart A, Streuli M: Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins. J Biol Chem. 1998 Jun 19;273(25):15611-20. 9624153
  7. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  8. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218
  9. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. 19349973
  10. Almo SC, Bonanno JB, Sauder JM, Emtage S, Dilorenzo TP, Malashkevich V, Wasserman SR, Swaminathan S, Eswaramoorthy S, Agarwal R, Kumaran D, Madegowda M, Ragumani S, Patskovsky Y, Alvarado J, Ramagopal UA, Faber-Barata J, Chance MR, Sali A, Fiser A, Zhang ZY, Lawrence DS, Burley SK: Structural genomics of protein phosphatases. J Struct Funct Genomics. 2007 Sep;8(2-3):121-40. Epub 2007 Dec 5. 18058037
  11. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974