You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePeptidyl-prolyl cis-trans isomerase G
Synonyms
  • 5.2.1.8
  • CARS-cyclophilin
  • CARS-Cyp
  • CASP10
  • Clk-associating RS-cyclophilin
  • Cyclophilin G
  • PPIase G
  • Rotamase G
  • SR-cyclophilin
  • SR-cyp
  • SRcyp
Gene NamePPIG
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037193|Peptidyl-prolyl cis-trans isomerase G
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
SKVKKEEKKRHKSSSSSSSSSSDSDSSSDSQSSSDSSDSESATEEKSKKRKKKHRKNSRK
HKKEKKKRKKSKKSASSESEAENLEAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERK
NRERERERECNPPNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPP
HWRQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKN
EKEKKVKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEKSKSKERDSKHNRN
EEKRMRSRSKGRDHENVKEKEKQSDSKGKDQERSRSKEKSKQLESKSNEHDHSKSKEKDR
RAQSRSRECDITKGKHSYNSRTRERSRSRDRSRRVRSRTHDRDRSRSKEYHRYREQEYRR
RGRSRSRERRTPPGRSRSKDRRRRRRDSRSSEREESQSRNKDKYRNQESKSSHRKENSES
EKRMYSKSRDHNSSNNSREKKADRDQSPFSKIKQSSQDNELKSSMLKNKEDEKIRSSVEK
ENQKSKGQENDHVHEKNKKFDHESSPGTDEDKSG
Number of residues754
Molecular Weight88616.535
Theoretical pI11.0
GO Classification
Functions
  • poly(A) RNA binding
  • peptidyl-prolyl cis-trans isomerase activity
  • cyclosporin A binding
Processes
  • protein peptidyl-prolyl isomerization
  • RNA splicing
  • protein folding
Components
  • nucleoplasm
  • nuclear matrix
  • nuclear speck
  • cytoplasm
  • nucleus
General FunctionPoly(a) rna binding
Specific FunctionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be implicated in the folding, transport, and assembly of proteins. May play an important role in the regulation of pre-mRNA splicing.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID1117968
UniProtKB IDQ13427
UniProtKB Entry NamePPIG_HUMAN
Cellular LocationNucleus matrix
Gene sequence
>lcl|BSEQ0019272|Peptidyl-prolyl cis-trans isomerase G (PPIG)
ATGGGAATAAAGGTTCAACGTCCTCGATGTTTTTTTGACATTGCCATTAACAATCAACCT
GCTGGAAGAGTTGTCTTTGAATTATTTTCTGATGTGTGCCCCAAAACATGCGAGAACTTT
CGTTGTCTTTGTACAGGTGAAAAGGGGACCGGGAAATCAACTCAGAAACCATTACATTAT
AAGAGTTGTCTCTTTCACAGAGTTGTCAAGGATTTTATGGTTCAAGGTGGTGACTTCAGT
GAAGGAAATGGACGAGGAGGGGAATCTATCTATGGAGGATTTTTTGAAGACGAGAGTTTC
GCTGTTAAACACAACAAAGAATTTCTCTTGTCAATGGCCAACAGAGGGAAGGATACAAAT
GGTTCACAGTTCTTCATAACAACGAAACCAACTCCTCATTTAGATGGGCATCATGTTGTT
TTTGGACAAGTAATCTCTGGTCAAGAAGTTGTAAGAGAGATTGAAAACCAGAAAACAGAT
GCAGCTAGCAAACCGTTTGCGGAGGTACGGATACTCAGTTGTGGAGAGCTGATTCCCAAA
TCTAAAGTTAAGAAAGAAGAAAAGAAAAGGCATAAATCATCATCATCTTCCTCCTCCTCA
TCTAGTGACTCAGATAGCTCAAGTGATTCTCAGTCCTCTTCTGATTCCTCTGATTCCGAA
AGTGCTACTGAAGAGAAATCAAAGAAAAGAAAAAAGAAACATCGGAAAAATTCCCGAAAA
CACAAGAAAGAAAAGAAAAAGCGAAAGAAAAGCAAGAAGAGTGCATCTAGTGAGAGTGAA
GCTGAAAATCTTGAAGCACAACCCCAGTCTACTGTCCGTCCAGAAGAGATCCCTCCTATA
CCTGAAAATAGATTCCTAATGAGAAAAAGTCCTCCTAAAGCTGATGAGAAGGAAAGGAAA
AACAGAGAGAGAGAAAGGGAAAGAGAGTGTAATCCACCTAACTCCCAGCCTGCTTCATAC
CAGAGACGACTTTTAGTTACTAGATCTGGCAGGAAAATTAAAGGAAGAGGACCAAGGCGT
TATCGAACTCCTTCCAGATCCAGATCAAGGGATCGTTTCAGACGTAGTGAGACTCCTCCA
CATTGGAGGCAAGAGATGCAGAGAGCTCAAAGAATGAGGGTATCAAGTGGTGAAAGATGG
ATCAAGGGGGATAAGAGTGAGTTGAATGAAATAAAAGAAAATCAGAGAAGTCCAGTTAGA
GTAAAAGAGAGAAAAATAACAGATCACAGGAATGTATCTGAGAGTCCAAACAGAAAAAAT
GAAAAGGAGAAGAAAGTTAAAGACCATAAATCTAACAGCAAAGAGAGAGACATCAGAAGA
AATTCAGAAAAAGATGACAAGTATAAAAACAAAGTGAAGAAAAGGGCCAAATCTAAAAGT
AGGAGTAAGAGCAAAGAGAAATCAAAGAGTAAAGAAAGAGATTCAAAACATAATAGAAAT
GAAGAAAAGAGGATGAGGTCAAGGAGTAAAGGAAGGGATCATGAAAATGTTAAAGAAAAA
GAAAAGCAGTCTGATTCTAAAGGAAAAGATCAGGAAAGGAGTAGAAGTAAAGAGAAGTCT
AAACAGTTAGAATCAAAGAGTAATGAGCATGATCACAGTAAAAGTAAGGAAAAGGATAGA
CGCGCACAATCCAGGAGTAGAGAATGTGATATAACTAAAGGTAAACACAGTTATAATAGC
AGAACAAGAGAACGAAGCAGAAGTAGGGACAGAAGCAGAAGAGTGCGATCAAGAACCCAT
GACAGAGATCGCAGCAGAAGCAAGGAGTACCATAGATACAGAGAACAGGAATACAGGAGA
AGAGGACGGTCACGAAGCCGAGAGAGAAGAACACCACCAGGAAGATCAAGAAGTAAAGAT
AGGAGGAGAAGGAGGAGAGACTCACGGAGCTCAGAGAGAGAAGAAAGTCAAAGCAGAAAC
AAAGACAAATACAGAAACCAAGAGAGTAAGAGCTCACACAGAAAAGAAAATTCTGAGAGT
GAGAAAAGAATGTACTCTAAAAGTCGTGATCATAATAGCTCAAATAACAGCAGGGAAAAA
AAGGCTGATAGAGATCAAAGTCCCTTCTCAAAAATAAAACAAAGCAGTCAGGACAATGAA
TTAAAGTCCTCCATGTTGAAAAATAAGGAGGATGAGAAGATCAGATCCTCAGTGGAAAAA
GAAAACCAAAAATCAAAAGGTCAAGAAAATGACCATGTACATGAAAAAAATAAAAAATTT
GATCATGAATCAAGCCCTGGAACAGATGAAGACAAAAGCGGATGA
GenBank Gene IDU40763
GeneCard IDNot Available
GenAtlas IDPPIG
HGNC IDHGNC:14650
Chromosome Location2
Locus2q31.1
References
  1. Nestel FP, Colwill K, Harper S, Pawson T, Anderson SK: RS cyclophilins: identification of an NK-TR1-related cyclophilin. Gene. 1996 Nov 21;180(1-2):151-5. 8973360
  2. Bourquin JP, Stagljar I, Meier P, Moosmann P, Silke J, Baechi T, Georgiev O, Schaffner W: A serine/arginine-rich nuclear matrix cyclophilin interacts with the C-terminal domain of RNA polymerase II. Nucleic Acids Res. 1997 Jun 1;25(11):2055-61. 9153302
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Lin CL, Leu S, Lu MC, Ouyang P: Over-expression of SR-cyclophilin, an interaction partner of nuclear pinin, releases SR family splicing factors from nuclear speckles. Biochem Biophys Res Commun. 2004 Aug 27;321(3):638-47. 15358154
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  7. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. 17525332
  8. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  9. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  10. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  11. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  12. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569