You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAquaporin-6
Synonyms
  • AQP-6
  • AQP2L
  • Aquaporin-2-like
  • hKID
  • Kidney-specific aquaporin
Gene NameAQP6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019653|Aquaporin-6
MDAVEPGGRGWASMLACRLWKAISRALFAEFLATGLYVFFGVGSVMRWPTALPSVLQIAI
TFNLVTAMAVQVTWKASGAHANPAVTLAFLVGSHISLPRAVAYVAAQLVGATVGAALLYG
VMPGDIRETLGINVVRNSVSTGQAVAVELLLTLQLVLCVFASTDSRQTSGSPATMIGISV
ALGHLIGIHFTGCSMNPARSFGPAIIIGKFTVHWVFWVGPLMGALLASLIYNFVLFPDTK
TLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV
Number of residues282
Molecular Weight29370.215
Theoretical pINot Available
GO Classification
Functions
  • glycerol channel activity
  • water channel activity
  • nitrate transmembrane transporter activity
  • anion channel activity
Processes
  • transmembrane transport
  • excretion
  • water transport
  • odontogenesis
  • cellular water homeostasis
  • glycerol transport
  • transport
  • anion transmembrane transport
Components
  • apical plasma membrane
  • transport vesicle membrane
  • integral component of plasma membrane
General FunctionWater channel activity
Specific FunctionForms a water-specific channel that participates in distinct physiological functions such as glomerular filtration, tubular endocytosis and acid-base metabolism.
Pfam Domain Function
Transmembrane Regions31-48 55-73 100-121 142-162 169-188 215-236
GenBank Protein IDNot Available
UniProtKB IDQ13520
UniProtKB Entry NameAQP6_HUMAN
Cellular LocationCytoplasmic vesicle membrane
Gene sequence
>lcl|BSEQ0019654|Aquaporin-6 (AQP6)
ATGGATGCAGTGGAGCCAGGGGGACGTGGCTGGGCCAGCATGTTGGCGTGCAGGCTTTGG
AAAGCCATCAGCAGGGCGCTGTTTGCAGAGTTCCTGGCCACGGGGCTGTATGTGTTCTTT
GGCGTGGGCTCAGTCATGCGCTGGCCCACAGCACTTCCCTCCGTGCTACAGATTGCCATC
ACCTTCAACCTGGTCACCGCCATGGCTGTGCAGGTCACCTGGAAGGCCAGCGGGGCCCAC
GCCAACCCCGCCGTGACGCTGGCCTTCCTCGTAGGCTCCCACATCTCTCTGCCCCGTGCT
GTGGCCTATGTGGCTGCCCAGCTGGTGGGGGCCACGGTGGGGGCTGCTCTGCTTTATGGG
GTCATGCCGGGAGACATCCGAGAGACCCTTGGGATCAACGTGGTCCGGAACAGTGTCTCA
ACTGGCCAGGCGGTGGCAGTGGAGCTGCTTCTGACCCTGCAGCTGGTGCTCTGTGTCTTC
GCTTCCACCGACAGCCGTCAGACATCAGGCTCCCCGGCCACCATGATTGGGATCTCTGTG
GCACTGGGCCACCTCATTGGGATCCACTTCACTGGCTGCTCCATGAATCCAGCCCGCTCC
TTCGGCCCTGCCATCATCATTGGGAAGTTCACAGTCCACTGGGTCTTCTGGGTGGGGCCC
CTGATGGGAGCCCTCCTGGCCTCACTGATCTACAACTTCGTCCTGTTCCCCGACACCAAG
ACCCTGGCGCAGCGGCTGGCTATCCTCACAGGCACCGTAGAGGTGGGGACAGGGGCAGGG
GCAGGGGCGGAGCCCCTGAAGAAGGAATCCCAGCCGGGTTCGGGAGCCGTGGAGATGGAG
AGTGTGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:639
Chromosome Location12
LocusNot Available
References
  1. Ma T, Yang B, Kuo WL, Verkman AS: cDNA cloning and gene structure of a novel water channel expressed exclusively in human kidney: evidence for a gene cluster of aquaporins at chromosome locus 12q13. Genomics. 1996 Aug 1;35(3):543-50. 8812490
  2. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. 16541075