You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein phosphatase 1 regulatory subunit 1A
Synonyms
  • I-1
  • IPP-1
  • IPP1
  • Protein phosphatase inhibitor 1
Gene NamePPP1R1A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019726|Protein phosphatase 1 regulatory subunit 1A
MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHL
KSTLAMSPRQRKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTETQESRPPGIPD
TEVESRLGTSGTAKKTAECIPKTHERGSKEPSTKEPSTHIPPLDSKGANSV
Number of residues171
Molecular Weight19011.15
Theoretical pINot Available
GO Classification
Functions
  • protein serine/threonine phosphatase inhibitor activity
Processes
  • negative regulation of protein kinase activity
  • glycogen metabolic process
  • intracellular signal transduction
Components
  • cytoplasm
  • extracellular space
General FunctionProtein serine/threonine phosphatase inhibitor activity
Specific FunctionInhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ13522
UniProtKB Entry NamePPR1A_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0019727|Protein phosphatase 1 regulatory subunit 1A (PPP1R1A)
ATGGAGCAAGACAACAGCCCCCGAAAGATCCAGTTCACGGTCCCGCTGCTGGAGCCGCAC
CTTGACCCCGAGGCGGCGGAGCAGATTCGGAGGCGCCGCCCCACCCCTGCCACCCTCGTG
CTGACCAGTGACCAGTCATCCCCAGAGATAGATGAAGACCGGATCCCCAACCCACATCTC
AAGTCCACTTTGGCAATGTCTCCACGGCAACGGAAGAAGATGACAAGGATCACACCCACA
ATGAAAGAGCTCCAGATGATGGTTGAACATCACCTGGGGCAACAGCAGCAAGGAGAGGAA
CCTGAGGGGGCCGCTGAGAGCACAGGAACCCAGGAGTCCCGCCCACCTGGGATCCCAGAC
ACAGAAGTGGAGTCAAGGCTGGGCACCTCTGGGACAGCAAAAAAAACTGCAGAATGCATC
CCTAAAACTCACGAGAGAGGCAGTAAGGAACCCAGCACAAAAGAACCCTCAACCCATATA
CCACCACTGGATTCCAAGGGAGCCAACTCGGTCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9286
Chromosome Location12
LocusNot Available
References
  1. Endo S, Zhou X, Connor J, Wang B, Shenolikar S: Multiple structural elements define the specificity of recombinant human inhibitor-1 as a protein phosphatase-1 inhibitor. Biochemistry. 1996 Apr 23;35(16):5220-8. 8611507
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Connor JH, Weiser DC, Li S, Hallenbeck JM, Shenolikar S: Growth arrest and DNA damage-inducible protein GADD34 assembles a novel signaling complex containing protein phosphatase 1 and inhibitor 1. Mol Cell Biol. 2001 Oct;21(20):6841-50. 11564868
  4. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569