You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNEDD8-activating enzyme E1 regulatory subunit
Synonyms
  • Amyloid beta precursor protein-binding protein 1, 59 kDa
  • Amyloid protein-binding protein 1
  • APP-BP1
  • APPBP1
  • Proto-oncogene protein 1
Gene NameNAE1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000403|NEDD8-activating enzyme E1 regulatory subunit
MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTII
DGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFF
CRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNAL
EDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEK
EDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQ
TPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNH
VAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPD
NEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVH
EFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL
Number of residues534
Molecular Weight60245.795
Theoretical pI5.06
GO Classification
Functions
  • protein heterodimerization activity
  • ubiquitin protein ligase binding
  • NEDD8 activating enzyme activity
Processes
  • regulation of neuron apoptotic process
  • mitotic DNA replication checkpoint
  • neuron apoptotic process
  • protein neddylation
  • signal transduction
  • regulation of apoptotic process
Components
  • cytosol
  • cytoplasm
  • nucleus
  • plasma membrane
General FunctionUbiquitin protein ligase binding
Specific FunctionRegulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Necessary for cell cycle progression through the S-M checkpoint. Overexpression of NAE1 causes apoptosis through deregulation of NEDD8 conjugation.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID1314560
UniProtKB IDQ13564
UniProtKB Entry NameULA1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010003|NEDD8-activating enzyme E1 regulatory subunit (NAE1)
ATGGATGCTCAGCAAACAAAAACAAATGAAGCCAGGTTGTGGGGTGATCATGGGCAAGAG
GCTTTAGAATCTGCTCATGTTTGCCTAATAAATGCAACAGCCACAGGAACTGAAATTCTT
AAAAACTTGGTACTACCAGGTATTGGTTCGTTTACAATTATTGATGGAAATCAGGTCAGC
GGAGAAGATGCTGGAAACAATTTCTTCCTTCAAAGAAGCAGTATCGGCAAGAACCGAGCT
GAAGCTGCCATGGAATTCTTACAAGAATTAAATAGCGATGTCTCTGGAAGTTTTGTGGAA
GAGAGTCCAGAAAACCTTCTAGACAATGATCCCTCATTTTTCTGTAGGTTTACTGTTGTA
GTTGCAACTCAGCTTCCTGAAAGCACTTCACTACGCTTAGCAGATGTCCTCTGGAATTCC
CAGATTCCTCTTTTGATCTGTAGGACATATGGACTAGTTGGTTATATGAGGATCATTATA
AAAGAACATCCAGTAATAGAATCTCATCCAGATAATGCATTAGAGGATCTACGACTAGAT
AAGCCATTTCCTGAACTGAGAGAACATTTTCAGTCCTATGATTTGGATCATATGGAAAAA
AAGGACCACAGTCATACTCCATGGATTGTGATCATAGCTAAATATTTAGCACAGTGGTAT
AGTGAAACAAATGGACGAATACCTAAAACGTATAAAGAAAAAGAGGACTTCAGAGATTTG
ATTAGACAAGGAATTCTAAAAAATGAAAATGGGGCTCCAGAAGATGAAGAGAATTTTGAA
GAAGCTATTAAAAATGTGAACACAGCACTAAATACAACTCAGATCCCAAGCAGTATTGAA
GATATATTTAATGATGATCGCTGCATAAATATCACCAAACAGACTCCATCATTTTGGATT
TTAGCTCGTGCCTTAAAGGAATTTGTGGCCAAAGAGGGTCAAGGAAATTTACCTGTTCGA
GGCACAATTCCTGATATGATTGCAGATTCAGGCAAATATATAAAACTGCAAAACGTTTAC
CGTGAAAAAGCAAAGAAAGATGCTGCCGCTGTGGGTAATCATGTTGCCAAATTGCTGCAG
TCCATTGGCCAGGCACCAGAGTCCATTTCAGAGAAAGAATTAAAATTACTCTGCAGCAAT
TCTGCATTTCTTCGAGTGGTAAGATGTCGATCCTTAGCTGAAGAATATGGTTTGGATACA
ATTAACAAGGATGAAATTATTTCTAGCATGGACAATCCAGATAATGAAATAGTGTTGTAC
TTAATGTTACGGGCTGTTGATAGATTTCATAAACAACAGGGTAGATATCCAGGAGTATCT
AACTATCAAGTTGAAGAAGATATAGGAAAGTTGAAGTCTTGTCTCACTGGCTTCCTTCAG
GAATATGGTTTATCTGTAATGGTGAAAGATGATTATGTCCACGAATTTTGCCGATATGGA
GCTGCTGAGCCACATACCATTGCTGCATTCTTGGGGGGAGCTGCTGCTCAAGAGGTCATC
AAAATAATCACCAAACAATTTGTAATTTTTAATAATACTTACATTTACAGTGGCATGTCA
CAAACTTCAGCAACTTTCCAGTTGTAG
GenBank Gene IDU50939
GeneCard IDNot Available
GenAtlas IDAPPBP1
HGNC IDHGNC:621
Chromosome Location16
Locus16q22
References
  1. Chow N, Korenberg JR, Chen XN, Neve RL: APP-BP1, a novel protein that binds to the carboxyl-terminal region of the amyloid precursor protein. J Biol Chem. 1996 May 10;271(19):11339-46. 8626687
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. 10493829
  4. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. 11230166
  5. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. 15616553
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Gong L, Yeh ET: Identification of the activating and conjugating enzymes of the NEDD8 conjugation pathway. J Biol Chem. 1999 Apr 23;274(17):12036-42. 10207026
  8. Chen Y, McPhie DL, Hirschberg J, Neve RL: The amyloid precursor protein-binding protein APP-BP1 drives the cell cycle through the S-M checkpoint and causes apoptosis in neurons. J Biol Chem. 2000 Mar 24;275(12):8929-35. 10722740
  9. Bohnsack RN, Haas AL: Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer. J Biol Chem. 2003 Jul 18;278(29):26823-30. Epub 2003 May 10. 12740388
  10. Chen Y, Liu W, McPhie DL, Hassinger L, Neve RL: APP-BP1 mediates APP-induced apoptosis and DNA synthesis and is increased in Alzheimer's disease brain. J Cell Biol. 2003 Oct 13;163(1):27-33. 14557245
  11. Chen Y, Liu W, Naumovski L, Neve RL: ASPP2 inhibits APP-BP1-mediated NEDD8 conjugation to cullin-1 and decreases APP-BP1-induced cell proliferation and neuronal apoptosis. J Neurochem. 2003 May;85(3):801-9. 12694406
  12. Park Y, Yoon SK, Yoon JB: TRIP12 functions as an E3 ubiquitin ligase of APP-BP1. Biochem Biophys Res Commun. 2008 Sep 19;374(2):294-8. doi: 10.1016/j.bbrc.2008.07.019. Epub 2008 Jul 15. 18627766
  13. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  14. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  15. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  16. Walden H, Podgorski MS, Huang DT, Miller DW, Howard RJ, Minor DL Jr, Holton JM, Schulman BA: The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1. Mol Cell. 2003 Dec;12(6):1427-37. 14690597
  17. Walden H, Podgorski MS, Schulman BA: Insights into the ubiquitin transfer cascade from the structure of the activating enzyme for NEDD8. Nature. 2003 Mar 20;422(6929):330-4. 12646924
  18. Huang DT, Miller DW, Mathew R, Cassell R, Holton JM, Roussel MF, Schulman BA: A unique E1-E2 interaction required for optimal conjugation of the ubiquitin-like protein NEDD8. Nat Struct Mol Biol. 2004 Oct;11(10):927-35. Epub 2004 Sep 7. 15361859