Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTubulin alpha-3C/D chain
Synonyms
  • Alpha-tubulin 2
  • Alpha-tubulin 3C/D
  • TUBA2
  • Tubulin alpha-2 chain
Gene NameTUBA3C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0002829|Tubulin alpha-3C/D chain
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY
Number of residues450
Molecular Weight49959.145
Theoretical pI4.74
GO Classification
Functions
  • GTP binding
  • GTPase activity
  • structural constituent of cytoskeleton
Processes
  • microtubule-based process
  • protein folding
  • 'de novo' posttranslational protein folding
  • cellular protein metabolic process
Components
  • microtubule
  • nucleus
  • cytoplasm
General FunctionStructural constituent of cytoskeleton
Specific FunctionTubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID2843123
UniProtKB IDQ13748
UniProtKB Entry NameTBA3C_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0010999|Tubulin alpha-3C/D chain (TUBA3C)
ATGCGCGAGTGTATCTCTATCCACGTGGGGCAGGCGGGTGTCCAGATCGGCAATGCCTGC
TGGGAACTGTACTGCCTTGAACATGGAATTCAGCCCGATGGCCAAATGCCAAGTGATAAA
ACCATTGGTGGCGGGGACGACTCCTTCAACACGTTCTTCAGTGAGACTGGAGCTGGCAAG
CACGTGCCCAGAGCAGTGTTTGTGGACCTGGAGCCCACTGTGGTCGATGAAGTGCGCACA
GGGACCTACAGGCAGCTCTTCCACCCGGAGCAGCTGATCACCGGGAAGGAAGATGCAGCC
AATAATTACGCCAGGGGCCATTACACCATCGGCAAGGAGATTGTTGACCTAGTCCTGGAC
CGGATCCGCAAACTGGCGGATCTGTGCACAGGACTGCAGGGCTTCCTCATCTTCCACAGC
TTTGGGGGCGGCACTGGCTCTGGGTTCGCATCTCTGCTCATGGAGCGGCTCTCAGTGGAT
TACGGCAAGAAGTCCAAGCTAGAGTTTGCCATTTACCCAGCCCCCCAGGTCTCCACAGCC
GTGGTGGAGCCCTACAACTCCATCCTGACCACCCACACGACCCTGGAACATTCTGACTGT
GCCTTCATGGTCGACAATGAAGCCATCTATGACATATGTCGGCGCAACCTGGACATTGAA
CGTCCCACGTACACCAACCTCAATCGCCTGATTGGGCAGATCGTGTCCTCCATCACAGCC
TCCCTGCGATTTGATGGGGCCCTGAATGTGGACTTGACGGAATTCCAGACCAACCTAGTG
CCGTACCCCCGCATCCACTTCCCCCTGGCCACCTATGCCCCAGTCATCTCAGCTGAGAAG
GCCTACCACGAGCAGCTGTCTGTGGCCGAGATCACCAATGCCTGCTTCGAGCCAGCCAAT
CAAATGGTCAAGTGTGACCCTCGCCACGGCAAGTACATGGCCTGCTGCATGTTGTACAGG
GGGGACGTGGTCCCCAAAGACGTCAACGCGGCCATCGCCACCATCAAGACCAAGCGCACC
ATCCAGTTTGTGGATTGGTGCCCGACTGGATTTAAGGTGGGCATTAACTACCAGCCCCCC
ACAGTGGTCCCCGGGGGAGACCTGGCCAAGGTGCAGCGGGCCGTGTGCATGCTGAGCAAC
ACCACGGCCATTGCGGAGGCCTGGGCCCGCCTGGACCATAAGTTCGATCTCATGTATGCC
AAGCGGGCCTTTGTGCACTGGTACGTGGGCGAAGGCATGGAAGAGGGAGAGTTCTCTGAG
GCCCGCGAGGACCTGGCAGCTCTAGAGAAGGATTATGAAGAGGTGGGCGTGGATTCCGTG
GAAGCTGAGGCTGAAGAAGGCGAAGAATACTGA
GenBank Gene IDAF005392
GeneCard IDNot Available
GenAtlas IDTUBA3C
HGNC IDHGNC:12408
Chromosome Location13
Locus13q11
References
  1. Dode C, Weil D, Levilliers J, Crozet F, Chaib H, Levi-Acobas F, Guilford P, Petit C: Sequence characterization of a newly identified human alpha-tubulin gene (TUBA2). Genomics. 1998 Jan 1;47(1):125-30. 9465305
  2. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. 15057823
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Rogowski K, Juge F, van Dijk J, Wloga D, Strub JM, Levilliers N, Thomas D, Bre MH, Van Dorsselaer A, Gaertig J, Janke C: Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation. Cell. 2009 Jun 12;137(6):1076-87. doi: 10.1016/j.cell.2009.05.020. 19524510