You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCYP2B protein
Synonyms
  • CYP2B7
  • Cytochrome P450 2B7 short isoform
Gene NameCYP2B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010738|CYP2B protein
MELSVLLFLALLTGLLLLLVQRHPNSHGTLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDNAEAFSGRGKIVIMDPVYQGYGMLFANGNR
WKVLRRFSVTTMRDFGMGKRSVEERIQDEAQCLIEELRKSKGALVDPTFLFHSITANIIC
SIIFGKRFHYQDQEFLKTLNLFCQSFLLISSISSQLFELFSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSAPRDLIDTYLLHMEKEKSNPHSEFSHQNLIINTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYKEIEQVVGPHRPPALDDRAKMPYTEAVIREIQRFA
DLLPMGVPHIVTQHTSF
Number of residues377
Molecular Weight43147.81
Theoretical pI9.03
GO Classification
Functions
  • heme binding
  • oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
  • iron ion binding
General FunctionOxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID181294
UniProtKB IDQ14097
UniProtKB Entry NameQ14097_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0002094|1134 bp
ATGGAGCTCAGCGTCCTCCTCTTCCTTGCACTCCTCACAGGCCTCTTGCTACTCCTGGTT
CAGCGTCACCCTAACTCCCATGGCACCCTCCCACCAGGGCCCCGCCCTCTGCCCCTTTTG
GGGAACCTTCTGCAGATGGACAGAAGAGGCCTACTCAAATCCTTTCTGAGGTTCCGAGAG
AAATATGGGGACGTCTTCACGGTACACCTGGGACCGAGGCCCGTGGTCATGCTGTGTGGA
GTAGAGGCCATACGGGAGGCCCTGGTGGACAACGCTGAGGCCTTCTCTGGCCGGGGAAAA
ATCGTCATCATGGACCCAGTCTACCAGGGATATGGCATGCTCTTTGCCAATGGAAACCGC
TGGAAGGTGCTTCGGCGATTCTCTGTGACCACCATGAGGGACTTCGGGATGGGAAAGCGG
AGTGTGGAGGAGCGGATTCAGGACGAGGCTCAGTGTCTGATAGAGGAACTTCGGAAATCC
AAGGGAGCCCTCGTGGACCCCACCTTCCTCTTCCATTCCATTACCGCCAACATCATCTGC
TCCATCATCTTTGGAAAACGCTTCCACTACCAAGATCAAGAGTTCCTGAAGACGCTGAAC
TTGTTCTGCCAGAGTTTCTTACTCATCAGCTCTATATCCAGCCAGCTGTTTGAGCTCTTC
TCTGGCTTCTTGAAATACTTTCCTGGGGCACACAGGCAAGTTTACAAAAACCTACAGGAA
ATCAATGCTTACATTGGCCACAGTGTGGAGAAGCACCGTGAAACCCTGGACCCCAGCGCC
CCCAGGGACCTCATCGACACCTACCTGCTCCACATGGAAAAAGAGAAATCCAACCCACAC
AGTGAATTCAGCCACCAGAACCTCATCATCAACACGCTCTCGCTCTTCTTTGCTGGCACT
GAGACCACCAGCACCACTCTCCGCTACGGCTTCCTGCTCATGCTCAAATACCCTCATGTC
GCAGAGAGAGTCTACAAGGAGATTGAACAGGTGGTTGGCCCACATCGCCCTCCAGCGCTT
GATGACCGAGCCAAAATGCCATACACAGAGGCAGTCATCCGTGAGATTCAGAGATTTGCT
GACCTTCTCCCCATGGGTGTGCCCCACATTGTCACCCAACACACCAGCTTCTGA
GenBank Gene IDM29873
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
Locus19q13.2
References
  1. Yamano S, Nhamburo PT, Aoyama T, Meyer UA, Inaba T, Kalow W, Gelboin HV, McBride OW, Gonzalez FJ: cDNA cloning and sequence and cDNA-directed expression of human P450 IIB1: identification of a normal and two variant cDNAs derived from the CYP2B locus on chromosome 19 and differential expression of the IIB mRNAs in human liver. Biochemistry. 1989 Sep 5;28(18):7340-8. 2573390