You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameN-arachidonyl glycine receptor
Synonyms
  • G-protein coupled receptor 18
  • GPCRW
  • NAGly receptor
Gene NameGPR18
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004524|N-arachidonyl glycine receptor
MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIY
MMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRY
MAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIY
LKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQ
VLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISV
MLYRNYLRSMRRKSFRSGSLRSLSNINSEML
Number of residues331
Molecular Weight38133.27
Theoretical pI9.56
GO Classification
Functions
  • G-protein coupled receptor activity
Processes
  • G-protein coupled receptor signaling pathway
Components
  • plasma membrane
  • integral component of membrane
General FunctionG-protein coupled receptor activity
Specific FunctionReceptor for N-arachidonyl glycine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. May contribute to regulation of the immune system.
Pfam Domain Function
Transmembrane Regions27-47 57-77 96-116 139-159 192-212 233-253 269-289
GenBank Protein ID1066731
UniProtKB IDQ14330
UniProtKB Entry NameGPR18_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0011660|N-arachidonyl glycine receptor (GPR18)
ATGATCACCCTGAACAATCAAGATCAACCTGTCCCTTTTAACAGCTCACATCCAGATGAA
TACAAAATTGCAGCCCTTGTCTTCTATAGCTGTATCTTCATAATTGGATTATTTGTTAAC
ATCACTGCATTATGGGTTTTCAGTTGTACCACCAAGAAGAGAACCACGGTAACCATCTAT
ATGATGAATGTGGCATTAGTGGACTTGATATTTATAATGACTTTACCCTTTCGAATGTTT
TATTATGCAAAAGATGAATGGCCATTTGGAGAGTACTTCTGCCAGATTCTTGGAGCTCTC
ACAGTGTTTTACCCAAGCATTGCTTTATGGCTTCTTGCCTTTATTAGTGCTGACAGATAC
ATGGCCATTGTACAGCCGAAGTACGCCAAAGAACTTAAAAACACGTGCAAAGCCGTGCTG
GCGTGTGTGGGAGTCTGGATAATGACCCTGACCACGACCACCCCTCTGCTACTGCTCTAT
AAAGACCCAGATAAAGACTCCACTCCCGCCACCTGCCTCAAGATTTCTGACATCATCTAT
CTAAAAGCTGTGAACGTGCTGAACCTCACTCGACTGACATTTTTTTTCTTGATTCCTTTG
TTCATCATGATTGGGTGCTACTTGGTCATTATTCATAATCTCCTTCACGGCAGGACGTCT
AAGCTGAAACCCAAAGTCAAGGAGAAGTCCATAAGGATCATCATCACGCTGCTGGTGCAG
GTGCTCGTCTGCTTTATGCCCTTCCACATCTGTTTCGCTTTCCTGATGCTGGGAACGGGG
GAGAACAGTTACAATCCCTGGGGAGCCTTTACCACCTTCCTCATGAACCTCAGCACGTGT
CTGGATGTGATTCTCTACTACATCGTTTCAAAACAATTTCAGGCTCGAGTCATTAGTGTC
ATGCTATACCGTAATTACCTTCGAAGCATGCGCAGAAAAAGTTTCCGATCTGGTAGTCTA
CGGTCACTAAGCAATATAAACAGTGAAATGTTATGA
GenBank Gene IDL42324
GeneCard IDNot Available
GenAtlas IDGPR18
HGNC IDHGNC:4472
Chromosome Location13
Locus13q32
References
  1. Gantz I, Muraoka A, Yang YK, Samuelson LC, Zimmerman EM, Cook H, Yamada T: Cloning and chromosomal localization of a gene (GPR18) encoding a novel seven transmembrane receptor highly expressed in spleen and testis. Genomics. 1997 Jun 15;42(3):462-6. 9205118
  2. Kohno M, Hasegawa H, Inoue A, Muraoka M, Miyazaki T, Oka K, Yasukawa M: Identification of N-arachidonylglycine as the endogenous ligand for orphan G-protein-coupled receptor GPR18. Biochem Biophys Res Commun. 2006 Sep 1;347(3):827-32. Epub 2006 Jul 10. 16844083
  3. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. 15057823
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334