You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHepatocyte nuclear factor 4-gamma
Synonyms
  • HNF-4-gamma
  • NR2A2
  • Nuclear receptor subfamily 2 group A member 2
Gene NameHNF4G
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037221|Hepatocyte nuclear factor 4-gamma
MNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDK
RNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVS
SPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHL
LLGATKRSMMYKDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACL
KAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITW
QMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMS
TLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
Number of residues408
Molecular Weight45876.235
Theoretical pI8.43
GO Classification
Functions
  • RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding
  • zinc ion binding
  • steroid hormone receptor activity
  • sequence-specific DNA binding
  • transcription factor activity, sequence-specific DNA binding
Processes
  • regulation of transcription from RNA polymerase II promoter
  • endocrine pancreas development
  • gene expression
  • transcription initiation from RNA polymerase II promoter
Components
  • nucleoplasm
General FunctionZinc ion binding
Specific FunctionTranscription factor. Has a lower transcription activation potential than HNF4-alpha.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ14541
UniProtKB Entry NameHNF4G_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0020665|Hepatocyte nuclear factor 4-gamma (HNF4G)
ATGGACATGGCAAATTACAGTGAAGTTTTGGACCCAACTTACACAACTTTGGAGTTTGAA
ACTATGCAGATTCTATATAATTCAAGTGATAGTTCTGCCCCAGAGACAAGTATGAATACC
ACAGACAACGGTGTCAACTGTCTGTGTGCTATCTGTGGGGACAGAGCAACAGGAAAACAC
TATGGGGCATCCAGCTGTGATGGGTGCAAGGGTTTCTTCAGACGCAGCATTCGTAAGAGT
CACGTTTATTCTTGCAGGTTCAGTCGGCAATGTGTTGTTGACAAGGACAAAAGGAATCAA
TGTAGATATTGTCGATTAAGAAAGTGTTTTAGAGCGGGAATGAAAAAAGAAGCTGTACAA
AATGAACGTGACAGAATAAGCACCAGAAGAAGCACATTTGATGGCAGCAACATCCCCTCC
ATTAACACACTGGCACAAGCTGAAGTTCGGTCTCGCCAGATCTCAGTCTCAAGCCCTGGG
TCAAGCACTGACATAAACGTTAAGAAAATTGCAAGTATTGGTGATGTCTGTGAATCTATG
AAACAGCAGCTCTTAGTCTTGGTGGAATGGGCTAAATATATTCCTGCCTTCTGTGAATTA
CCATTGGATGATCAGGTGGCACTGTTGAGAGCTCACGCAGGGGAGCACTTACTGCTTGGA
GCTACAAAGAGATCCATGATGTATAAAGATATTTTGCTTTTGGGAAACAACTATGTTATT
CACCGCAACAGCTGTGAAGTTGAGATTAGCCGTGTGGCCAATCGTGTTCTAGATGAGCTG
GTTAGACCATTTCAAGAAATCCAGATTGATGACAATGAGTATGCTTGTTTAAAGGCAATT
GTATTTTTTGATCCAGATGCAAAAGGGCTAAGCGATCCAGTAAAAATTAAGAACATGAGG
TTCCAAGTGCAGATCGGTTTGGAGGACTACATCAATGATCGGCAGTATGACTCCCGGGGG
AGGTTTGGAGAGTTGCTTCTGCTCCTGCCCACACTGCAGAGCATCACGTGGCAAATGATT
GAGCAAATACAGTTTGTTAAACTTTTTGGGATGGTTAAAATTGACAATCTACTTCAGGAA
ATGCTATTAGGTGGGGCTTCCAATGATGGCAGTCATCTCCATCATCCAATGCATCCACAT
TTGTCTCAAGACCCATTAACTGGACAAACTATACTTTTAGGTCCCATGTCAACACTGGTT
CATGCAGACCAGATCTCAACTCCTGAAACCCCACTCCCTTCCCCACCACAAGGCTCTGGG
CAAGAACAGTACAAAATAGCTGCAAACCAAGCATCAGTCATTTCACACCAGCATCTCTCC
AAACAAAAGCAATTGTGA
GenBank Gene IDZ49826
GeneCard IDNot Available
GenAtlas IDHNF4G
HGNC IDHGNC:5026
Chromosome Location8
Locus8q21.11
References
  1. Drewes T, Senkel S, Holewa B, Ryffel GU: Human hepatocyte nuclear factor 4 isoforms are encoded by distinct and differentially expressed genes. Mol Cell Biol. 1996 Mar;16(3):925-31. 8622695
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  3. Plengvidhya N, Antonellis A, Wogan LT, Poleev A, Borgschulze M, Warram JH, Ryffel GU, Krolewski AS, Doria A: Hepatocyte nuclear factor-4gamma: cDNA sequence, gene organization, and mutation screening in early-onset autosomal-dominant type 2 diabetes. Diabetes. 1999 Oct;48(10):2099-102. 10512380
  4. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. 16421571
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  7. Wisely GB, Miller AB, Davis RG, Thornquest AD Jr, Johnson R, Spitzer T, Sefler A, Shearer B, Moore JT, Miller AB, Willson TM, Williams SP: Hepatocyte nuclear factor 4 is a transcription factor that constitutively binds fatty acids. Structure. 2002 Sep;10(9):1225-34. 12220494