You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameEquilibrative nucleoside transporter 2
Synonyms
  • 36 kDa nucleolar protein HNP36
  • Delayed-early response protein 12
  • DER12
  • ENT2
  • Equilibrative NBMPR-insensitive nucleoside transporter
  • Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter
  • HNP36
  • Hydrophobic nucleolar protein, 36 kDa
  • Nucleoside transporter, ei-type
  • Solute carrier family 29 member 2
Gene NameSLC29A2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008557|Equilibrative nucleoside transporter 2
MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTG
PEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVD
MSPGPFFSITMASVCFINSFSAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLL
SMASGVDAETSALGYFITPCVGILMSIVCYLSLPHLKFARYYLANKSSQAQAQELETKAE
LLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLV
FTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSYFLWPDEDSRL
LPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL
Number of residues456
Molecular Weight50112.335
Theoretical pINot Available
GO Classification
Functions
  • nucleoside transmembrane transporter activity
Processes
  • cell proliferation
  • transmembrane transport
  • nucleobase-containing compound metabolic process
  • nucleoside transmembrane transport
  • nucleoside transport
Components
  • plasma membrane
  • nuclear membrane
  • nucleolus
  • integral component of plasma membrane
  • basolateral plasma membrane
General FunctionNucleoside transmembrane transporter activity
Specific FunctionMediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. Very less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
Pfam Domain Function
Transmembrane Regions13-33 70-90 99-119 124-144 162-182 193-213 291-311 324-344 360-380 386-406 432-452
GenBank Protein IDNot Available
UniProtKB IDQ14542
UniProtKB Entry NameS29A2_HUMAN
Cellular LocationBasolateral cell membrane
Gene sequence
>lcl|BSEQ0013271|Equilibrative nucleoside transporter 2 (SLC29A2)
ATGGCGCGAGGAGACGCCCCGCGGGACAGCTACCACCTGGTCGGGATCAGCTTCTTCATC
CTGGGGCTGGGCACCCTCCTTCCCTGGAACTTCTTCATCACCGCCATCCCGTACTTCCAG
GCGCGACTGGCCGGGGCCGGCAACAGCACAGCCAGGATCCTGAGCACCAACCACACGGGT
CCCGAGGATGCCTTCAACTTCAACAATTGGGTGACGCTGCTGTCCCAGCTGCCCCTGCTG
CTCTTCACCCTCCTCAACTCCTTCCTGTACCAGTGCGTCCCGGAGACGGTGCGCATTCTG
GGCAGCCTGCTGGCCATACTGCTGCTCTTTGCCCTGACAGCAGCGCTGGTCAAGGTGGAC
ATGAGCCCCGGACCCTTCTTCTCCATCACCATGGCCTCCGTCTGCTTCATCAACTCCTTC
AGTGCAGTCCTACAGGGCAGCCTCTTCGGGCAGCTGGGCACCATGCCCTCCACCTACAGC
ACCCTCTTCCTCAGCGGCCAGGGCCTGGCTGGGATCTTTGCTGCCCTTGCCATGCTCCTG
TCCATGGCCAGTGGCGTGGACGCCGAGACCTCTGCCCTGGGGTACTTTATCACGCCCTGT
GTGGGCATCCTCATGTCCATCGTGTGTTACCTGAGCCTGCCTCACCTGAAGTTTGCCCGC
TACTACCTGGCCAATAAATCATCCCAGGCCCAAGCTCAGGAGCTGGAGACCAAAGCTGAG
CTCCTCCAGTCTGATGAGAACGGGATTCCCAGTAGTCCCCAGAAAGTAGCTCTGACCCTG
GATCTTGACCTGGAGAAGGAGCCGGAATCAGAGCCAGATGAGCCCCAGAAGCCAGGAAAA
CCTTCAGTCTTCACTGTCTTCCAGAAGATCTGGCTGACAGCGCTGTGCCTTGTGTTGGTC
TTCACAGTCACCCTGTCCGTCTTCCCCGCCATCACAGCCATGGTGACCAGCTCCACCAGT
CCTGGGAAGTGGAGTCAGTTCTTCAACCCCATCTGCTGCTTCCTCCTCTTCAACATCATG
GACTGGCTGGGACGGAGCCTGACCTCTTACTTCCTGTGGCCAGACGAGGACAGCCGGCTG
CTGCCCCTGCTGGTCTGCCTGCGGTTCCTGTTCGTGCCCCTCTTCATGCTGTGCCACGTG
CCCCAGAGGTCCCGGCTGCCCATCCTCTTCCCACAGGATGCCTACTTCATCACCTTCATG
CTGCTCTTTGCCGTTTCTAATGGCTACCTGGTGTCCCTCACCATGTGCCTGGCGCCCAGG
CAGGTGCTGCCACACGAGAGGGAGGTGGCCGGCGCCCTCATGACCTTCTTCCTGGCCCTG
GGACTTTCCTGTGGAGCCTCCCTCTCCTTCCTCTTCAAGGCGCTGCTCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:11004
Chromosome Location11
LocusNot Available
References
  1. Williams JB, Lanahan AA: A mammalian delayed-early response gene encodes HNP36, a novel, conserved nucleolar protein. Biochem Biophys Res Commun. 1995 Aug 4;213(1):325-33. 7639753
  2. Griffiths M, Yao SY, Abidi F, Phillips SE, Cass CE, Young JD, Baldwin SA: Molecular cloning and characterization of a nitrobenzylthioinosine-insensitive (ei) equilibrative nucleoside transporter from human placenta. Biochem J. 1997 Dec 15;328 ( Pt 3):739-43. 9396714
  3. Crawford CR, Patel DH, Naeve C, Belt JA: Cloning of the human equilibrative, nitrobenzylmercaptopurine riboside (NBMPR)-insensitive nucleoside transporter ei by functional expression in a transport-deficient cell line. J Biol Chem. 1998 Feb 27;273(9):5288-93. 9478986
  4. Mangravite LM, Xiao G, Giacomini KM: Localization of human equilibrative nucleoside transporters, hENT1 and hENT2, in renal epithelial cells. Am J Physiol Renal Physiol. 2003 May;284(5):F902-10. Epub 2003 Jan 14. 12527552
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  6. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Ward JL, Leung GP, Toan SV, Tse CM: Functional analysis of site-directed glycosylation mutants of the human equilibrative nucleoside transporter-2. Arch Biochem Biophys. 2003 Mar 1;411(1):19-26. 12590919
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  10. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  11. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  12. Owen RP, Lagpacan LL, Taylor TR, De La Cruz M, Huang CC, Kawamoto M, Johns SJ, Stryke D, Ferrin TE, Giacomini KM: Functional characterization and haplotype analysis of polymorphisms in the human equilibrative nucleoside transporter, ENT2. Drug Metab Dispos. 2006 Jan;34(1):12-5. Epub 2005 Oct 7. 16214850