You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMetabotropic glutamate receptor 7
Synonyms
  • GPRC1G
  • MGLUR7
Gene NameGRM7
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001664|Metabotropic glutamate receptor 7
MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
Number of residues915
Molecular Weight102250.06
Theoretical pI7.94
GO Classification
Functions
  • group III metabotropic glutamate receptor activity
  • PDZ domain binding
  • calcium channel regulator activity
  • voltage-gated calcium channel activity
  • serine binding
  • calcium ion binding
  • adenylate cyclase inhibitor activity
  • glutamate receptor activity
  • glutamate binding
Processes
  • conditioned taste aversion
  • negative regulation of adenylate cyclase activity
  • negative regulation of glutamate secretion
  • regulation of cyclase activity
  • regulation of synaptic transmission, glutamatergic
  • adult behavior
  • transmission of nerve impulse
  • synaptic transmission
  • negative regulation of cAMP biosynthetic process
  • short-term memory
  • sensory perception of smell
  • sensory perception of sound
  • multicellular organismal response to stress
  • adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway
Components
  • presynaptic membrane
  • dendritic shaft
  • presynaptic active zone
  • postsynaptic membrane
  • axon
  • plasma membrane
  • receptor complex
  • cell cortex
  • integral component of membrane
  • integral component of plasma membrane
  • asymmetric synapse
  • dendrite
General FunctionVoltage-gated calcium channel activity
Specific FunctionG-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
Pfam Domain Function
Transmembrane Regions591-615 628-648 655-675 703-723 754-775 789-810 826-850
GenBank Protein ID1370111
UniProtKB IDQ14831
UniProtKB Entry NameGRM7_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0021276|Metabotropic glutamate receptor 7 (GRM7)
ATGGTCCAGCTGAGGAAGCTGCTCCGCGTCCTGACTTTGATGAAGTTCCCCTGCTGCGTG
CTGGAGGTGCTCCTGTGCGCGCTGGCGGCGGCGGCGCGCGGCCAGGAGATGTACGCCCCG
CACTCAATCCGGATCGAGGGGGACGTCACCCTCGGGGGGCTGTTCCCCGTGCACGCCAAG
GGTCCCAGCGGAGTGCCCTGCGGCGACATCAAGAGGGAAAACGGGATCCACAGGCTGGAA
GCGATGCTCTACGCCCTGGACCAGATCAACAGTGATCCCAACCTACTGCCCAACGTGACG
CTGGGCGCGCGGATCCTGGACACTTGTTCCAGGGACACTTACGCGCTCGAACAGTCGCTT
ACTTTCGTCCAGGCGCTCATCCAGAAGGACACCTCCGACGTGCGCTGCACCAACGGCGAA
CCGCCGGTTTTCGTCAAGCCGGAGAAAGTAGTTGGAGTGATTGGGGCTTCGGGGAGTTCG
GTCTCCATCATGGTAGCCAACATCCTGAGGCTCTTCCAGATCCCCCAGATTAGTTATGCA
TCAACGGCACCCGAGCTAAGTGATGACCGGCGCTATGACTTCTTCTCTCGCGTGGTGCCA
CCCGATTCCTTCCAAGCCCAGGCCATGGTAGACATTGTAAAGGCCCTAGGCTGGAATTAT
GTGTCTACCCTCGCATCGGAAGGAAGTTATGGAGAGAAAGGTGTGGAGTCCTTCACGCAG
ATTTCCAAAGAGGCAGGTGGACTCTGCATTGCCCAGTCCGTGAGAATCCCCCAGGAACGC
AAAGACAGGACCATTGACTTTGATAGAATTATCAAACAGCTCCTGGACACCCCCAACTCC
AGGGCCGTCGTGATTTTTGCCAACGATGAGGATATAAAGCAGATCCTTGCAGCAGCCAAA
AGAGCTGACCAAGTTGGCCATTTTCTTTGGGTGGGATCAGACAGCTGGGGATCCAAAATA
AACCCACTGCACCAGCATGAAGATATCGCAGAAGGGGCCATCACCATTCAGCCCAAGCGA
GCCACGGTGGAAGGGTTTGATGCCTACTTTACGTCCCGTACACTTGAAAACAACAGAAGA
AATGTATGGTTTGCCGAATACTGGGAGGAAAACTTCAACTGCAAGTTGACGATTAGTGGG
TCAAAAAAAGAAGACACAGATCGCAAATGCACAGGACAGGAGAGAATTGGAAAAGATTCC
AACTATGAGCAGGAGGGTAAAGTCCAGTTCGTGATTGACGCAGTCTATGCTATGGCTCAC
GCCCTTCACCACATGAACAAGGATCTCTGTGCTGACTACCGGGGTGTCTGCCCAGAGATG
GAGCAAGCTGGAGGCAAGAAGTTGCTGAAGTATATACGCAATGTTAATTTCAATGGTAGT
GCTGGCACTCCAGTGATGTTTAACAAGAACGGGGATGCACCTGGGCGTTATGACATCTTT
CAGTACCAGACCACAAACACCAGCAACCCGGGTTACCGTCTGATCGGGCAGTGGACAGAC
GAACTTCAGCTCAATATAGAAGACATGCAGTGGGGTAAAGGAGTCCGAGAGATACCCGCC
TCAGTGTGCACACTACCATGTAAGCCAGGACAGAGAAAGAAGACACAGAAAGGAACTCCT
TGCTGTTGGACCTGTGAGCCTTGCGATGGTTACCAGTACCAGTTTGATGAGATGACATGC
CAGCATTGCCCCTATGACCAGAGGCCCAATGAAAATCGAACCGGATGCCAGGATATTCCC
ATCATCAAACTGGAGTGGCACTCCCCCTGGGCTGTGATTCCTGTCTTCCTGGCAATGTTG
GGGATCATTGCCACCATCTTTGTCATGGCCACTTTCATCCGCTACAATGACACGCCCATT
GTCCGGGCATCTGGGCGGGAACTCAGCTATGTTCTTTTGACGGGCATCTTTCTTTGCTAC
ATCATCACTTTCCTGATGATTGCCAAACCAGATGTGGCAGTGTGTTCTTTCCGGCGAGTT
TTCTTGGGCTTGGGTATGTGCATCAGTTATGCAGCCCTCTTGACGAAAACAAATCGGATT
TATCGCATATTTGAGCAGGGCAAGAAATCAGTAACAGCTCCCAGACTCATAAGCCCAACA
TCACAACTGGCAATCACTTCCAGTTTAATATCAGTTCAGCTTCTAGGGGTGTTCATTTGG
TTTGGTGTTGATCCACCCAACATCATCATAGACTATGATGAACACAAGACAATGAACCCT
GAGCAAGCCAGAGGGGTTCTCAAGTGTGACATTACAGATCTCCAAATCATTTGCTCCTTG
GGATATAGCATTCTTCTCATGGTCACATGTACTGTGTATGCCATCAAGACTCGGGGTGTA
CCCGAGAATTTTAACGAAGCCAAGCCCATTGGATTCACTATGTACACGACATGTATAGTA
TGGCTTGCCTTCATTCCAATTTTTTTTGGCACCGCTCAATCAGCGGAAAAGCTCTACATA
CAAACTACCACGCTTACAATCTCCATGAACCTAAGTGCATCAGTGGCGCTGGGGATGCTA
TACATGCCGAAAGTGTACATCATCATTTTCCACCCTGAACTCAATGTCCAGAAACGGAAG
CGAAGCTTCAAGGCGGTAGTCACAGCAGCCACCATGTCATCGAGGCTGTCACACAAACCC
AGTGACAGACCCAACGGTGAGGCAAAGACCGAGCTCTGTGAAAACGTAGACCCAAACAGC
CCTGCTGCAAAAAAGAAGTATGTCAGTTATAATAACCTGGTTATCTAA
GenBank Gene IDX94552
GeneCard IDNot Available
GenAtlas IDGRM7
HGNC IDHGNC:4599
Chromosome Location3
Locus3p26.1-p25.1
References
  1. Makoff A, Pilling C, Harrington K, Emson P: Human metabotropic glutamate receptor type 7: molecular cloning and mRNA distribution in the CNS. Brain Res Mol Brain Res. 1996 Aug;40(1):165-70. 8840028
  2. Flor PJ, Van Der Putten H, Ruegg D, Lukic S, Leonhardt T, Bence M, Sansig G, Knopfel T, Kuhn R: A novel splice variant of a metabotropic glutamate receptor, human mGluR7b. Neuropharmacology. 1997 Feb;36(2):153-9. 9144652
  3. Wu S, Wright RA, Rockey PK, Burgett SG, Arnold JS, Rosteck PR Jr, Johnson BG, Schoepp DD, Belagaje RM: Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells. Brain Res Mol Brain Res. 1998 Jan;53(1-2):88-97. 9473604
  4. Schulz HL, Stohr H, Weber BH: Characterization of three novel isoforms of the metabotrobic glutamate receptor 7 (GRM7). Neurosci Lett. 2002 Jun 21;326(1):37-40. 12052533
  5. Bolonna AA, Kerwin RW, Munro J, Arranz MJ, Makoff AJ: Polymorphisms in the genes for mGluR types 7 and 8: association studies with schizophrenia. Schizophr Res. 2001 Jan 15;47(1):99-103. 11163549