Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMetal regulatory transcription factor 1
Synonyms
  • MRE-binding transcription factor
  • Transcription factor MTF-1
Gene NameMTF1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019658|Metal regulatory transcription factor 1
MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLED
EDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEG
ATLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKA
FLTSYSLRIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCSKYF
TTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTF
STQYSLKSHMKGHDNKGHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSELRENSSTTQGQ
DLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGDAESVSDVPPSTGNSASLSLP
LVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAA
NHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGA
NSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFF
TTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERASSRRKGCSSPPPPE
PSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQAETPSDPQTETLSAMDVSEF
LSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK
Number of residues753
Molecular Weight80956.22
Theoretical pINot Available
GO Classification
Functions
  • metal ion binding
  • core promoter binding
  • RNA polymerase II core promoter sequence-specific DNA binding
  • transcription coactivator activity
  • transcription factor activity, sequence-specific DNA binding
  • DNA binding
  • RNA polymerase II core promoter proximal region sequence-specific DNA binding
  • transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
Processes
  • transcription from RNA polymerase II promoter
  • positive regulation of transcription from RNA polymerase II promoter
  • response to cadmium ion
  • regulation of transcription from RNA polymerase II promoter
  • response to oxidative stress
  • response to metal ion
Components
  • nucleoplasm
  • nucleus
General FunctionTranscriptional activator activity, rna polymerase ii core promoter proximal region sequence-specific binding
Specific FunctionActivates the metallothionein I promoter. Binds to the metal responsive element (MRE).
Pfam Domain FunctionNot Available
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ14872
UniProtKB Entry NameMTF1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0019659|Metal regulatory transcription factor 1 (MTF1)
ATGGGGGAACACAGTCCAGACAACAACATCATCTACTTTGAGGCAGAGGAAGATGAGCTG
ACCCCCGATGATAAAATGCTCAGGTTTGTGGATAAAAACGGACTGGTGCCTTCCTCATCT
GGAACTGTTTATGATAGGACCACTGTTCTTATTGAGCAGGACCCTGGCACTTTGGAGGAT
GAAGATGACGACGGACAGTGCGGAGAACACTTGCCTTTTCTAGTAGGGGGTGAAGAGGGC
TTTCACCTGATAGATCATGAAGCAATGTCCCAGGGTTATGTGCAGCACATTATCTCACCA
GATCAGATTCATTTGACAATAAACCCTGGTTCCACACCCATGCCAAGAAATATTGAAGGT
GCAACCCTCACTCTGCAGTCGGAATGTCCGGAAACAAAACGTAAAGAAGTAAAGCGGTAC
CAATGTACCTTTGAGGGCTGTCCCCGCACCTACAGCACAGCAGGCAACCTGCGAACCCAC
CAGAAGACTCACCGAGGAGAGTACACCTTTGTCTGTAATCAGGAGGGCTGTGGCAAAGCC
TTCCTTACCTCTTACAGCCTCAGGATCCACGTGCGAGTGCACACGAAGGAGAAGCCATTT
GAGTGTGACGTGCAGGGCTGTGAGAAGGCATTCAACACACTGTACAGGCTGAAAGCACAT
CAGAGGCTTCACACAGGGAAAACGTTTAACTGTGAATCTGAAGGCTGCAGCAAATACTTC
ACCACACTCAGTGATCTGAGGAAGCACATTCGAACTCATACAGGGGAAAAGCCATTTCGG
TGCGATCACGATGGCTGTGGAAAAGCATTTGCAGCAAGCCACCACCTTAAAACTCACGTT
CGTACACATACTGGTGAAAGACCCTTCTTCTGCCCCAGTAATGGCTGTGAGAAAACATTC
AGCACTCAATACAGTCTCAAAAGTCACATGAAAGGTCATGATAACAAAGGACACTCATAC
AATGCACTTCCACAACACAATGGATCAGAGGATACAAATCACTCACTTTGTCTAAGTGAC
TTGAGCCTTCTGTCCACAGATTCTGAATTGCGAGAAAATTCCAGTACGACCCAGGGCCAG
GACCTCAGCACAATTTCACCAGCAATCATCTTTGAATCAATGTTCCAGAATTCAGATGAT
ACGGCAATTCAGGAAGATCCTCAACAGACAGCTTCCTTGACTGAAAGTTTTAATGGTGAT
GCAGAGTCAGTCAGTGATGTTCCGCCATCCACAGGAAATTCAGCATCTTTATCTCTTCCA
CTTGTACTGCAACCTGGCCTCTCCGAGCCACCCCAGCCTCTACTACCTGCCTCAGCTCCG
TCTGCTCCTCCGCCTGCTCCCTCCCTAGGACCTGGCTCCCAGCAAGCTGCATTTGGCAAC
CCCCCTGCTCTCTTACAACCTCCAGAAGTGCCTGTTCCCCACAGCACACAGTTTGCTGCT
AATCATCAAGAGTTTCTTCCGCACCCCCAGGCACCGCAGCCCATTGTACCAGGACTTTCT
GTTGTTGCTGGGGCTTCTGCATCAGCAGCGGCAGTGGCATCAGCTGTGGCAGCACCAGCC
CCACCACAAAGTACTACTGAGCCCCTGCCAGCCATGGTCCAGACTCTGCCCCTGGGTGCC
AACTCTGTCCTAACTAATAATCCCACAATAACCATCACCCCAACTCCCAACACAGCTATC
CTGCAGTCCAGCCTAGTCATGGGAGAACAGAACTTACAATGGATATTAAATGGTGCCACC
AGTTCTCCACAAAACCAAGAACAAATTCAGCAAGCATCTAAAGTTGAGAAGGTGTTTTTT
ACCACTGCAGTACCAGTAGCCAGTAGCCCAGGGAGCTCTGTCCAGCAGATTGGCCTCAGT
GTTCCTGTGATCATCATCAAACAAGAAGAGGCATGTCAGTGTCAGTGTGCATGCCGGGAC
TCTGCAAAGGAGCGGGCATCCAGCAGGAGAAAGGGCTGCTCCTCCCCACCCCCTCCAGAG
CCGAGCCCCCAGGCTCCTGATGGGCCCAGCCTGCAGCTCCCAGCGCAGACTTTCTCTTCA
GCCCCTGTTCCCGGGTCATCATCCTCTACCTTGCCCTCCTCCTGTGAGCAAAGCCGACAA
GCAGAGACTCCTTCAGACCCTCAGACAGAAACATTAAGTGCCATGGATGTGTCAGAGTTT
CTATCCCTCCAGAGCCTGGACACCCCGTCCAATCTGATTCCCATTGAAGCACTACTGCAG
GGGGAGGAGGAGATGGGCCTCACCAGCAGCTTCTCCAAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:7428
Chromosome Location1
LocusNot Available
References
  1. Brugnera E, Georgiev O, Radtke F, Heuchel R, Baker E, Sutherland GR, Schaffner W: Cloning, chromosomal mapping and characterization of the human metal-regulatory transcription factor MTF-1. Nucleic Acids Res. 1994 Aug 11;22(15):3167-73. 8065932
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334