You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamate receptor ionotropic, NMDA 2C
Synonyms
  • GluN2C
  • Glutamate [NMDA] receptor subunit epsilon-3
  • N-methyl D-aspartate receptor subtype 2C
  • NMDAR2C
  • NR2C
Gene NameGRIN2C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010317|Glutamate receptor ionotropic, NMDA 2C
MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPL
EIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHVSWRLLDVVTLELGPGGPRARTQRLLRQLDAPVFVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYWRQHGTLPAPAGDCRVHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPAFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WKLRHSVPNSSQLDFLLAFSRGIYSCFSGVQSLASPPRQASPDLTASSAQASVLKMLQAA
RDMVTTAGVSSSLDRATRTIENWGGGRRAPPPSPCPTPRSGPSPCLPTPDPPPEPSPTGW
GPPDGGRAALVRRAPQPPGRPPTPGPPLSDVSRVSRRPAWEARWPVRTGHCGRHLSASER
PLSPARCHYSSFPRADRSGRPFLPLFPELEDLPLLGPEQLARREALLHAAWARGSRPRHA
SLPSSVAEAFARPSSLPAGCTGPACARPDGHSACRRLAQAQSMCLPIYREACQEGEQAGA
PAWQHRQHVCLHAHAHLPFCWGAVCPHLPPCASHGSWLSGAWGPLGHRGRTLGLGTGYRD
SGGLDEISRVARGTQGFPGPCTWRRISSLESEV
Number of residues1233
Molecular Weight134207.77
Theoretical pI8.61
GO Classification
Functions
  • extracellular-glutamate-gated ion channel activity
  • NMDA glutamate receptor activity
  • cation channel activity
Processes
  • response to wounding
  • synaptic transmission
  • neuromuscular process controlling balance
  • axon guidance
  • excitatory postsynaptic potential
  • epidermal growth factor receptor signaling pathway
  • protein localization
  • innate immune response
  • Fc-epsilon receptor signaling pathway
  • glutamate receptor signaling pathway
  • activation of MAPKK activity
  • synaptic transmission, glutamatergic
  • fibroblast growth factor receptor signaling pathway
  • insulin receptor signaling pathway
  • ion transmembrane transport
  • transport
  • ionotropic glutamate receptor signaling pathway
  • MAPK cascade
  • directional locomotion
  • neurotrophin TRK receptor signaling pathway
  • negative regulation of protein catabolic process
  • Ras protein signal transduction
  • vascular endothelial growth factor receptor signaling pathway
  • small GTPase mediated signal transduction
Components
  • postsynaptic density
  • cell junction
  • integral component of plasma membrane
  • NMDA selective glutamate receptor complex
  • intracellular
  • postsynaptic membrane
  • plasma membrane
  • dendrite
General FunctionNmda glutamate receptor activity
Specific FunctionNMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
Pfam Domain Function
Transmembrane Regions554-574 627-647 815-835
GenBank Protein ID1196449
UniProtKB IDQ14957
UniProtKB Entry NameNMDE3_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010318|Glutamate receptor ionotropic, NMDA 2C (GRIN2C)
ATGGGTGGGGCCCTGGGGCCGGCCCTGTTGCTCACCTCGCTCTTCGGTGCCTGGGCAGGG
CTGGGTCCGGGGCAGGGCGAGCAGGGCATGACGGTGGCCGTGGTGTTTAGCAGCTCAGGG
CCGCCCCAGGCCCAGTTCCGTGCCCGCCTCACCCCCCAGAGCTTCCTGGACCTACCCCTG
GAGATCCAGCCGCTCACAGTTGGGGTCAACACCACCAACCCCAGCAGCCTCCTCACCCAG
ATCTGCGGCCTCCTGGGTGCTGCCCACGTCCACGGCATTGTCTTTGAGGACAACGTGGAC
ACCGAGGCGGTGGCCCAGATCCTTGACTTCATCTCCTCCCAGACCCATGTGCCCATCCTC
AGCATCAGCGGAGGCTCTGCTGTGGTCCTCACCCCCAAGGAGCCGGGCTCCGCCTTCCTG
CAGCTGGGCGTGTCCCTGGAGCAGCAGCTGCAGGTGCTGTTCAAGGTGCTGGAAGAGTAC
GACTGGAGCGCCTTCGCCGTCATCACCAGCCTGCACCCGGGCCACGCGCTCTTCCTGGAG
GGCGTGCGCGCCGTCGCCGACGCCAGCCACGTGAGTTGGCGGCTGCTGGACGTGGTCACG
CTGGAGCTGGGCCCGGGAGGGCCGCGCGCGCGCACGCAGCGCCTGCTGCGCCAGCTCGAC
GCGCCCGTGTTTGTGGCCTACTGCTCGCGCGAGGAGGCCGAGGTGCTCTTCGCCGAGGCG
GCGCAGGCCGGTCTGGTGGGGCCCGGCCACGTGTGGCTGGTGCCCAACCTGGCGCTGGGC
AGCACCGATGCGCCCCCCGCCACCTTCCCCGTGGGCCTCATCAGCGTCGTCACCGAGAGC
TGGCGCCTCAGCCTGCGCCAGAAGGTGCGCGACGGCGTGGCCATTCTGGCCCTGGGCGCC
CACAGCTACTGGCGCCAGCATGGAACCCTGCCAGCCCCGGCCGGGGACTGCCGTGTTCAC
CCTGGGCCCGTCAGCCCTGCCCGGGAGGCCTTCTACAGGCACCTACTGAATGTCACCTGG
GAGGGCCGAGACTTCTCCTTCAGCCCTGGTGGGTACCTGGTCCAGCCCACCATGGTGGTG
ATCGCCCTCAACCGGCACCGCCTCTGGGAGATGGTGGGGCGCTGGGAGCATGGCGTCCTA
TACATGAAGTACCCCGTGTGGCCTCGCTACAGTGCCTCTCTGCAGCCTGTGGTGGACAGT
CGGCACCTGACGGTGGCCACGCTGGAAGAGCGGCCCTTTGTCATCGTGGAGAGCCCTGAC
CCTGGCACAGGAGGCTGTGTCCCCAACACCGTGCCCTGCCGCAGGCAGAGCAACCACACC
TTCAGCAGCGGGGACGTGGCCCCCTACACCAAGCTCTGCTGTAAGGGATTCTGCATCGAC
ATCCTCAAGAAGCTGGCCAGAGTGGTCAAATTCTCCTACGACCTGTACCTGGTGACCAAC
GGCAAGCATGGCAAGCGGGTGCGCGGCGTATGGAACGGCATGATTGGGGAGGTGTACTAC
AAGCGGGCAGACATGGCCATCGGCTCCCTCACCATCAATGAGGAACGCTCCGAGATCGTA
GACTTCTCTGTACCCTTTGTGGAGACGGGCATCAGTGTGATGGTGGCTCGCAGCAATGGC
ACCGTCTCCCCCTCGGCCTTCTTGGAGCCATATAGCCCTGCAGTGTGGGTGATGATGTTT
GTCATGTGCCTCACTGTGGTGGCCATCACCGTCTTCATGTTCGAGTACTTCAGCCCTGTC
AGCTACAACCAGAACCTCACCAGAGGCAAGAAGTCCGGGGGCCCAGCTTTCACTATCGGC
AAGTCCGTGTGGCTGCTGTGGGCGCTGGTCTTCAACAACTCAGTGCCCATCGAGAACCCG
CGGGGCACCACCAGCAAGATCATGGTTCTGGTCTGGGCCTTCTTTGCTGTCATCTTCCTC
GCCAGCTACACGGCCAACCTGGCCGCCTTCATGATCCAAGAGCAATACATCGACACTGTG
TCGGGCCTCAGTGACAAGAAGTTTCAGCGGCCTCAAGATCAGTACCCACCTTTCCGCTTC
GGCACGGTGCCCAACGGCAGCACGGAGCGGAACATCCGCAGTAACTACCGTGACATGCAC
ACCCACATGGTCAAGTTCAACCAGCGCTCGGTGGAGGACGCGCTCACCAGCCTCAAGATG
GGGAAGCTGGATGCCTTCATCTATGATGCTGCTGTCCTCAACTACATGGCAGGCAAGGAC
GAGGGCTGCAAGCTGGTCACCATTGGGTCTGGCAAGGTCTTTGCTACCACTGGCTACGGC
ATCGCCATGCAGAAGGACTCCCACTGGAAGCGGGCCATAGACCTGGCGCTCTTGCAGTTC
CTGGGGGACGGAGAGACACAGAAACTGGAGACAGTGTGGCTCTCAGGGATCTGCCAGAAT
GAGAAGAACGAGGTGATGAGCAGCAAGCTGGACATCGACAACATGGCAGGCGTCTTCTAC
ATGCTGCTGGTGGCCATGGGGCTGGCCCTGCTGGTCTTCGCCTGGGAGCACCTGGTCTAC
TGGAAGCTGCGCCACTCGGTGCCCAACTCATCCCAGCTGGACTTCCTGCTGGCTTTCAGC
AGGGGCATCTACAGCTGCTTCAGCGGGGTGCAGAGCCTCGCCAGCCCACCGCGGCAGGCC
AGCCCGGACCTCACGGCCAGCTCGGCCCAGGCCAGCGTGCTCAAGATGCTGCAGGCAGCC
CGCGACATGGTGACCACGGCGGGCGTAAGCAGCTCCCTGGACCGCGCCACTCGCACCATC
GAGAATTGGGGTGGCGGCCGCCGTGCGCCCCCACCGTCCCCCTGCCCGACCCCGCGGTCT
GGCCCCAGCCCATGCCTGCCCACCCCCGACCCGCCCCCAGAGCCGAGCCCCACGGGCTGG
GGACCGCCAGACGGGGGTCGCGCGGCGCTTGTGCGCAGGGCTCCGCAGCCCCCGGGCCGC
CCCCCGACGCCGGGGCCGCCCCTGTCCGACGTCTCCCGAGTGTCGCGCCGCCCAGCCTGG
GAGGCGCGGTGGCCGGTGCGGACCGGGCACTGCGGGAGGCACCTCTCGGCCTCCGAGCGG
CCCCTGTCGCCCGCGCGCTGTCACTACAGCTCCTTTCCTCGAGCCGACCGATCCGGCCGC
CCCTTCCTCCCGCTCTTCCCGGAGCTGGAGGACCTGCCGCTGCTCGGTCCGGAGCAGCTG
GCCCGGCGGGAGGCCCTGCTGCACGCGGCCTGGGCCCGGGGCTCGCGCCCGCGTCACGCT
TCCCTGCCCAGCTCCGTGGCCGAGGCCTTCGCTCGGCCCAGCTCGCTGCCCGCTGGGTGC
ACCGGCCCCGCCTGCGCCCGCCCCGACGGCCACTCGGCCTGCAGGCGCTTGGCGCAGGCG
CAGTCGATGTGCTTGCCGATCTACCGGGAGGCCTGCCAGGAGGGCGAGCAGGCAGGGGCC
CCCGCCTGGCAGCACAGACAGCACGTCTGCCTGCACGCCCACGCCCACCTGCCATTTTGC
TGGGGGGCTGTCTGTCCTCACCTTCCACCCTGTGCCAGCCACGGCTCCTGGCTCTCCGGG
GCCTGGGGGCCTCTGGGGCACAGGGGCAGGACTCTGGGGCTGGGCACAGGCTACAGAGAC
AGTGGGGGACTGGACGAGATCAGCAGGGTAGCCCGTGGGACGCAAGGCTTCCCGGGACCC
TGCACCTGGAGACGGATCTCCAGTCTGGAGTCAGAAGTGTGA
GenBank Gene IDL76224
GeneCard IDNot Available
GenAtlas IDGRIN2C
HGNC IDHGNC:4587
Chromosome Location17
Locus17q25
References
  1. Lin YJ, Bovetto S, Carver JM, Giordano T: Cloning of the cDNA for the human NMDA receptor NR2C subunit and its expression in the central nervous system and periphery. Brain Res Mol Brain Res. 1996 Dec 31;43(1-2):57-64. 9037519
  2. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Cai L, Loo LS, Atlashkin V, Hanson BJ, Hong W: Deficiency of sorting nexin 27 (SNX27) leads to growth retardation and elevated levels of N-methyl-D-aspartate receptor 2C (NR2C). Mol Cell Biol. 2011 Apr;31(8):1734-47. doi: 10.1128/MCB.01044-10. Epub 2011 Feb 7. 21300787